top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr12|120701612|120701770|1|158|0 | NA | MLEC | LAGEAVGVDRAGFPSGLSPSDPTPSMPNQLFASSHNMH | LAGEAVGVDR | No | Alternative | Junction | 10 | 1 | TTG | TGA | NA | No |
chr12|121830342|121830668|1|326|0 | circSETD1B(NE) | SETD1B | LSSTQRPFRAWRPTLPPGAPGSGPSAGKGFSVVQPTSLSF | AWRPTLPPGAPGSGPSAGK | No | Alternative | Alternative | 19 | 1 | CTG | TAA | NA | Yes |
chr12|122859197|122859373|1|176|0 | circENST00000536617(NE) | ENST00000536617 | LHPPLGWLNRCLCVEPAASGHRVGTMHPPRSLWSPTSFPGCP | CLCVEPAASGHR | No | Alternative | Alternative | 12 | 1 | CTG | TGA | NA | No |
chr12|124333129|124333279|1|150|0 | circNCOR2(1L) | NCOR2 | LCTRCCTGMGNRRSPGLQSQTRRRSWVVVRTVLNLCPHRRA | RSWVVVR | No | Alternative | Junction | 7 | 3 | CTG | TGA | NA | No |
chr12|3615185|3615415|1|230|0 | NA | CRACR2A | LHRCHPPGPAQSFSLSVTHLPQKEGKHIPSGELSERGHHSGRPPC | HIPSGELSER | No | Junction | Junction | 10 | 3 | CTG | TAA | NA | No |
Page 1 of 1
bottom of page