top of page

Long-Read CircRNA Encoded Peptides

Use criteria below to search among 2,148 circRNA peptides detected by long-read sequencing:

*Click CircRNA to view comprehensive information in new page. 

*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"

*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)

CircRNA
CircRNA UID
Gene
ORF
Peptide
ORF Found in Short-Read
Peptide Type
ORF Type
Peptide Length
Frame
Start Codon
Stop Codon
Ribo-Seq Peptide Support
chr9|5821758|5821930|1|172|0
circENST00000214893(NE)
ENST00000214893
MENTQTHSCLHGALTFFTIGKKTECPLSFRIFFCCFLIWWLLHVSWR
TECPLSFR
No
Alternative
Junction
8
1
ATG
TGA
NA
chr9|5821758|5821930|1|172|0
circENST00000214893(NE)
ENST00000214893
MENTQTHSCLHGALTFFTIGKKTECPLSFRIFFCCFLIWWLLHVSWR
TECPLSFRIFFCCFLIWWLLHVSWR
No
Junction
Junction
25
1
ATG
TGA
NA
chr9|6757970|6758203|1|233|0
circKDM4C(L1)
KDM4C
LCACAANSCHLVRNKSPKFPKSPWAGGHCLLFLLHRVVLSPQPARQGEPAVRAPSPLPPTHPLDGRVRRGAVIGRPGSCARAQRTAVT
QGEPAVR
No
Alternative
Junction
7
3
CTG
TAG
NA
chr9|72210686|72219506|3|29,57,28|0,3248,8792
circGDA(NE,S2,4)
GDA
MEQPLTLFQNTRRPLRNRSRKLRDLCQKCSKRTGEH
MEQPLTLFQNTR
No
Alternative
Junction
12
2
ATG
TAA
TransCirc
chr9|72250089|72250419|1|330|0
circGDA(NE)
GDA
LLLAFARSYTFTFFKGVHFDVEHQFSCRLRTHVQ
LLLAFAR
No
Alternative
Alternative
7
1
CTG
TAA
NA
Page 1 of 430
bottom of page