top of page

lncRNA Peptides

Use criteria below to search among 5,856 circRNA peptides detected by short-read sequencing:

*Click CircRNA to view comprehensive information in new page. 

*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end posotion|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"

CircRNA
Gene
ORF
Peptide
ORF Found in Long-Read
Peptide Type
ORF Type
Peptide Length
Frame
Start Codon
Stop Codon
chrY|1412731|1428121|-|6|circRNA|ASMTL|NM_001173474_DUP1|11,10,9,8,7,6
ASMTL
LSCTSCAGSCMTGQTTKSTSYSAGSPRAASQGQSWRLRDPGPGRHAGGVRTRGLSERGGIPAEPLLQAAGEALLPAPSGGPAAECQARLHPGRGHLRRPQ
DPGPGRHAGGVR
No
Alternative
Junction
12
1
CTG
TGA
chrY|1421657|1432377|-|4|circRNA|ASMTL|NM_001173474_DUP1|8,7,6,5
ASMTL
LASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKAEDLFQTISWTPGSRNSTRKRR
AEDLFQTISWTPGSRNSTR
No
Junction
Junction
19
3
CTG
TGA
chrY|1593443|1595532|+|2|circRNA|AKAP17A|ENSTR0000313871.7|2,3
AKAP17A
MPQLRSGSWRGRSFRNWSSKEKNKSAERRKRRRGSERRKGPRSRRLWQRLPSCTTRLRPWSSALLTACT
LWQRLPSCTTR
No
Alternative
Junction
11
2
ATG
TGA
chrY|1599191|1599432|+|1|circRNA|AKAP17A|ENSTR0000313871.7|4
AKAP17A
LEELERERKREEKLRKREQKQRDRELRRNQKKLEKLQAEEQKQLQEKIKLEERKLLLAQRNLQSIRLIAELLSRAKETKGAGRAGAREEKRREASQEGAEAEGP
EASQEGAEAEGP
No
Alternative
Junction
12
2
CTG
TGA
chrY|19043162|19044695|-|2|circRNA|TTTY14|ENST00000447937.1|6,5
TTTY14
MREARCARWTLGSSFVPASPRFQGSSLNKGNYCSSGGCEDVGDLRAEL
FQGSSLNKGNYCSSGGCEDVGDLR
No
Alternative
Alternative
24
1
ATG
TAG
Page 1 of 3,514
bottom of page