top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SUMF1-5:2 | OV | 13 | 0.832983 | coding | 52 | chr3 | 5137628 | 5187338 | - | 0.9949 | lnc-SUMF1-5 | 0.415 | 0 | 0 | 0 | 16 | noncoding | -0.326856421 | ESVTALSHIAEVR | n[145]ESVTALSHIAEVR | MDCMLALYQDKDAWGNKTCKESVTALSHIAEVRSQSNPLILSREYEPLLLPL |
lnc-SUMF1-5:2 | OV | 13 | 0.832983 | coding | 49 | chr3 | 5137628 | 5187338 | - | 0.9849 | lnc-SUMF1-5 | 0.072 | 0 | 0 | 0 | 17 | noncoding | -0.326856421 | ISEQTVEEGSAHK | n[145]ISEQTVEEGSAHK | MISEQTVEEGSAHKRKESFVIGKSKLKWGRGRGYNLLRVIIKLTHLGRL |
lnc-SUMF1-5:2 | OV | 7 | 0.832983 | coding | 49 | chr3 | 5137628 | 5187338 | - | 0.434 | lnc-SUMF1-5 | 0.072 | 0 | 0 | 0 | 3 | noncoding | -0.326856421 | LKWGRGR | n[145]LKWGRGR | MISEQTVEEGSAHKRKESFVIGKSKLKWGRGRGYNLLRVIIKLTHLGRL |
lnc-SUMF1-5:6 | OV | 12 | 0.0274124 | noncoding | 35 | chr3 | 5180837 | 5187338 | - | 0.8375 | lnc-SUMF1-5 | 0.267 | 0 | 0 | 0 | 1 | noncoding | -0.325976087 | NPQKPSNTAVIK | n[145]NPQKPSNTAVIK | MAPLHSSLGNRVRLHLKTNKQKNPQKPSNTAVIKD |
lnc-SUMF1-8:1 | PRAD | 20 | 0.161343 | noncoding | 46 | chr3 | 5690542 | 5699338 | - | 0.6266 | lnc-SUMF1-8 | 0.049 | 0 | 0 | 0 | 4 | noncoding | -0.387766178 | MNKPGLSAMQEETGWQLGER | M[147]NKPGLSAM[147]QEETGWQLGER | MNKPGLSAMQEETGWQLGERILTYHGDQVTLCTDPELKVFQHTRHP |
Page 1 of 1
bottom of page