lncRNA Peptides

Use criteria below to search among 19,871 unique lncRNA peptides:

arrow&v
arrow&v

*Click Transcript to view full ORF and comprehensive information in new page. 

Transcript*
Cancer
Peptide Length
CPC Coding Probability
CPC Label
ORF Length
Chromosome
Start
End
Strand
Max Probability
Gene Name
Conservation Score
PhyloCSF Frame 1
PhyloCSF Frame 2
PhyloCSF Frame 3
No. of Spectra
CNTI Index
CNTI Score
Peptide
Modified Peptide
ORF
ZNF433-AS1:30
BRCA-Luminal A
8
0.0602026
noncoding
58
chr19
11987655
12004778
+
0.9997
ZNF433-AS1
0.368
0
0
0
2
noncoding
-0.376002684
MSLSDRPR
n[145]MSLSDRPR
MPLRCSLGNESETLSQKKKKKKKKKRMSLSDRPRSLKLSWDLDRRKIHSTHTGICRHR
ZNF433-AS1:30
BRCA-Luminal B
8
0.0602026
noncoding
58
chr19
11987655
12004778
+
0.9997
ZNF433-AS1
0.368
0
0
0
2
noncoding
-0.376002684
MSLSDRPR
n[145]MSLSDRPR
MPLRCSLGNESETLSQKKKKKKKKKRMSLSDRPRSLKLSWDLDRRKIHSTHTGICRHR
ZNF451-AS1:42
BRCA-Luminal B
12
0.017921
noncoding
34
chr6
57164880
57171049
-
0.9953
ZNF451-AS1
0.763
-5.186
-4.575
-4.122
7
noncoding
-0.472026598
ETTHHIQESLNK
n[145]ETTHHIQESLNK
LRRVIVKLSKAKDNENNKRETTHHIQESLNKITS
ZNF451-AS1:42
BRCA-HER2-enriched
12
0.017921
noncoding
34
chr6
57164880
57171049
-
0.9953
ZNF451-AS1
0.763
-5.186
-4.575
-4.122
7
noncoding
-0.472026598
ETTHHIQESLNK
n[145]ETTHHIQESLNK
LRRVIVKLSKAKDNENNKRETTHHIQESLNKITS
ZNF451-AS1:42
BRCA-Basal-like
12
0.017921
noncoding
34
chr6
57164880
57171049
-
0.9953
ZNF451-AS1
0.763
-5.186
-4.575
-4.122
7
noncoding
-0.472026598
ETTHHIQESLNK
n[145]ETTHHIQESLNK
LRRVIVKLSKAKDNENNKRETTHHIQESLNKITS
Page 1 of 5,988