CircRNA Peptides

Use criteria below to search among 3,238 unique circRNA peptides:

arrow&v
arrow&v

*Click CircRNA to view full amino acid sequences spanning backsplice junctions and comprehensive information in new page. 

CircRNA*
Cancer
Peptide
Type of Peptide
Highest Probability Peptide Matching Spectra
No. of Amino Acids from 5' Exons
No. of Amino Acids from 3' Exons
No. of Spectra
Amino Acids from 5' Exons
Amino Acids from 3' Exons
chr6|81751589|81752178|-|FAM46A|ENST00000320172.10
PRAD
WALLGLLR
noncanonical_peptide
0.9999
0
8
46
DPGPSGARRALHGGGRVLRHVGRAGLQPLHPPRRRLRRRRLRRRRLRRRRLRRWRQLRWALLGLLRKPYGALQCAELGASAAAGRHPERDHSDSRARQLPHARAAAEPDREGGAAAPGREAHWRPRRAPQRLGSQPCPAPGQRPGLQGPGPHLLRRPARGRGVSDCEGRRAGLPVGLLTRGGEQREDHTTHAQ,TDQGQVALGGHYMAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLK,LTRAKWRSAGTTWRRVKGTSPCLRTSWPAAPTSPAATSAAATSAAATSAAATSAVAAASVGIAWTIAKALRRTAMCTGSKCSGWTASARPFRFTGAATSPRSSCSRASRWCGGAWPRSALASATCASTARQPAMSCTRTAAWATRTWTSSSAPTCAGKGSFRLRTSCWTACWTSYPRGTKRRSHHSRS
DPGPSGARRALHGGGRVLRHVGRAGLQPLHPPRRRLRRRRLRRRRLRRRRLRRWRQLRWALLGLLRKPYGALQCAELGASAAAGRHPERDHSDSRARQLPHARAAAEPDREGGAAAPGREAHWRPRRAPQRLGSQPCPAPGQRPGLQGPGPHLLRRPARGRGVSDCEGRRAGLPVGLLTRGGEQREDHTTHAQ,TDQGQVALGGHYMAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLK,LTRAKWRSAGTTWRRVKGTSPCLRTSWPAAPTSPAATSAAATSAAATSAAATSAVAAASVGIAWTIAKALRRTAMCTGSKCSGWTASARPFRFTGAATSPRSSCSRASRWCGGAWPRSALASATCASTARQPAMSCTRTAAWATRTWTSSSAPTCAGKGSFRLRTSCWTACWTSYPRGTKRRSHHSRS
chr19|45619059|45621637|-|EML2|ENST00000245925.7
PRAD
WCLEGAVIGGWSSGVLTTASCR
noncanonical_peptide
0.9369
0
22
9
GHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE,AMWKSCGAWPHTPVGPSLPAGRISWCIYGAQIPTSPCGAGSS,PCGRAVGPGHTPQSGPVCDLRAGAGASMELRFPPAPVEQDHR
VGTVSHRRCWAPTTAACLGSAPCGTGRWCLEGAVIGGWSSGVLTTASCRKW,WEPYHTGGAGRPRRRRVWALRPAGRDAGVWRGPSAGGPLGFLQQAAGSG,GNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVE
chr11|83471625|83541858|-|DLG2|ENST00000280241.12
PRAD
WGSSPAKG
noncanonical_peptide
0.9344
0
8
2
TTPGRLSWGPRIGSMTTYLNSLINLAPVCL,KLHPAGDYPGAHEGSDQRLDIIPIWLLCA,NYTRPVIILGPMKDRINDDLISEFPDKFGSCVP
SHVRLRQEQGQWAAKSRTFIWRYSPRYQCLVVASQESHAGGRQGDGGHPQQKE,AMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDSEEMGVIPSKR,PCSTTTRARTVGCQVKDLVLNMEIFSTLSMPLMMSGGKPGESCWRETVRRWGSSPAKG
chr15|54235029|54300373|+|UNC13C|ENST00000260323.15
PRAD
YGIESIYQAMTAGGGLYGIDSMPDLR
junction_peptide
0.989
16
10
30
GWRWTLWYQHAGSSQKKNFAYCPRC,AGGGLYGIDSMPDLRRKKTLPIVRDV,LEVDFMVLTACRIFAEKKLCLLSEM
NLFHYLTEVKSNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAM,ICSITLKNLMVEKSQKSKGMKPGRFSLMMLPKKLMNLLCVMELNPFIKL,SVPLLDSEIWWSENPRSQRGSLEGFLCFPRNSICYALWNIHLSSYD
chr7|122098449|122133741|-|AASS|ENST00000417368.6
PRAD
YIGLDWAGWGSASPR
junction_peptide
0.9426
0
15
2
DLTRIKLNSARNIILILLAWTFVNKKRSWASWWQNRILSS,IHEESNTVRQEIYSCHGHLTRREAGLLGGKTGSCHQ,SDMKNQIEQLGKKYNINPVSMDICKQEEKLGFLVAKQDLVI
SPGVKMLQVHRTGLGRLGVSLSKGLHHKAVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDK,HQVSRCCKYIGLDWAGWGSASPRVFTTKLCWPSGGRMTPGREGPRLPSTSKASPIWDTRSYSLRIGGPFMI,TRCQDAASTDWTGQAGGQPLQGSSPQSCVGRPEGGCERLGEKGPASSQAHQRHHQSGIQGLDTAFESAGHS
Page 1 of 1,236