top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr10|71287765|71288546|+|1|ciRNA|UNC5B|NM_001244889|6 | ciUNC5B(6) | UNC5B | LSMSSPTPNPVPPSVLCARAGTAILSPAWGAEGACPEPTAGCPG | AGTAILSPAWGAEGACPEPTAGCPG | No | Alternative | Alternative | 25 | 2 | TTG | TGA | NA | No |
chr10|73068845|73074915|-|4|circRNA|P4HA1|ENST00000307116.6|5,4,3,2 | circP4HA1(5,4,3,2) | P4HA1 | MMKIRLGQPKLCYVSRIPTIWIQIPSQRVIFQVCDPVKLNLPR | IRLGQPK | No | Alternative | Junction | 7 | 1 | ATG | TGA | TransCirc | No |
chr10|73192555|73193593|+|2|circRNA|FAM149B1|NM_173348|4,5 | circFAM149B1(4,5) | FAM149B1 | LYPRSPSAVSASYETTLSQERDSTMNSIKMPLKKSRQCSQPLMNSCMSRS | SPSAVSASYETTLSQERDSTMNSIK | No | Junction | Junction | 25 | 2 | TTG | TGA | TransCirc | No |
chr10|73454411|73475030|-|7|circRNA|PPP3CB|ENST00000360663.9|10,9,8,7,6,5,4 | circPPP3CB(10,9,8,7,6,5,4) | PPP3CB | MLVNVLSICSDDELMTEGEDQFDVCLIFMGSEDSIPKHIISSERQP | MLVNVLSICSDDELMTEGEDQFDVCLIFMGSEDSIPK | No | Junction | Junction | 37 | 3 | ATG | TGA | TransCirc | No |
chr10|73516374|73530835|-|7|circRNA|USP54|ENST00000424265.5|12,11,10,9,8,7,6 | circUSP54(12,11,10,9,8,7,6) | USP54 | LNPLHSTGKVYLKHQGGLRRILIIVGSHWMPQRVSCKALGVTTAVAASSLHKKEEALLKNSCSKKRRILLTPPR | ILIIVGSHWMPQR | No | Alternative | Alternative | 13 | 3 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page