top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr10|63189167|63189446|-|1|circRNA|JMJD1C|NM_001282948|17 | circJMJD1C(17) | JMJD1C | LQWMKIINYTVIYHILGSVRSIFYGLRIIRIAVIGSFSKNVGNKDRVAKVDGLCLTFLMT | IAVIGSFSKNVGNK | No | Alternative | Junction | 14 | 2 | CTG | TAA | NA | No |
chr10|63189167|63189446|-|1|circRNA|JMJD1C|NM_001282948|17 | circJMJD1C(17) | JMJD1C | LQWMKIINYTVIYHILGSVRSIFYGLRIIRIAVIGSFSKNVGNKDRVAKVDGLCLTFLMT | IINYTVIYHILGSVR | No | Alternative | Junction | 15 | 2 | CTG | TAA | NA | No |
chr10|63189167|63189446|-|1|circRNA|JMJD1C|NM_001282948|17 | circJMJD1C(17) | JMJD1C | LQWMKIINYTVIYHILGSVRSIFYGLRIIRIAVIGSFSKNVGNKDRVAKVDGLCLTFLMT | IINYTVIYHILGSVRSIFYGLR | No | Alternative | Junction | 22 | 2 | CTG | TAA | NA | No |
chr10|63192937|63194375|-|3|circRNA|JMJD1C|NM_001282948|15,14,13 | circJMJD1C(15,14,13) | JMJD1C | MFLITVIKFLCACLSLSSKILLRSLRKMVAAAQRVM | MVAAAQR | No | Alternative | Alternative | 7 | 2 | ATG | TAG | NA | No |
chr10|63193344|63197563|-|3|circRNA|JMJD1C|NM_001282948|14,13,12 | circJMJD1C(14,13,12) | JMJD1C | LTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQPKLPGKEQ | QNLQVGNFPTMNGVSQPKLPGK | No | Junction | Junction | 22 | 3 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page