top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|27462293|27463592|2|224,79|0,1220 | circGTF3C1(S1L,S1S) | GTF3C1 | LASPRAPCCATTRGSCSPSPCWSCSRVHREFRSCQHLPGSTGKVGVGFWLRGQALMSSPLPAGTVRVSASSAGRGVSWMAT | SCQHLPGSTGK | No | Alternative | Junction | 11 | 2 | CTG | TGA | NA | Yes |
chr16|27462293|27463592|2|224,79|0,1220 | circGTF3C1(S1L,S1S) | GTF3C1 | LLHRPAVACRGWPPEPSCMQGYDGGHAVPHHDQAWHPRELPAAPLPGGPAARRRAGVAPGFTESFGAANISQAARERWVWGSGSGAKP | WVWGSGSGAKP | No | Alternative | Junction | 11 | 3 | CTG | TGA | TransCirc | Yes |
chr16|2763874|2764042|1|168|0 | circSRRM2(S1L) | SRRM2 | LECLLSRAGSSLTLLHILQWTRILSWGRVDWRLLNQKRKWPYPKIEVSSQRVLC | WPYPKIEVSSQR | No | Junction | Junction | 12 | 1 | CTG | TGA | TransCirc | Yes |
chr16|28357060|28758305|4|70,107,253,132|0,113804,286895,401113 | NA | XM_005255741 | LALSIVRHHRGHQGLVEREYKAPGRQKGSAIRQTFFGLGPPLANLGLYTPSPPIPDDPGGASQWTMPKGDKKVLLSAKPSSVWALP | GHQGLVER | No | Alternative | Junction | 8 | 1 | TTG | TAG | NA | No |
chr16|29146503|29146753|1|250|0 | circT129736(S1S) | T129736 | LNLSPESRWAAPAARPRRAVPQGWPGPQCDGAGLTRRRPPEVPFTSFVQLDSLILQGGKSN | AVPQGWPGPQCDGAGLTRR | No | Alternative | Junction | 19 | 1 | CTG | TGA | NA | No |
Page 1 of 1
bottom of page