top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr11|95789013|95789176|1|163|0 | circFAM76B(S1L) | FAM76B | LGVSGVGLSEAATCLCRRDPGVEMFSSRFSAWSVLFFHQEAGDGGPGGCRAPSASGGLRSGVE | APSASGGLR | No | Alternative | Junction | 9 | 1 | CTG | TGA | NA | Yes |
chr12|111485270|111486824|2|60,59|0,1495 | circATXN2(S1L,S3S).A | ATXN2 | LNPNAKEFNPRSFSLYPIPMTPMPVNQAKTYRAGKLGNQH | EFNPRSFSLYPIPMTPMPVNQAK | No | Alternative | Junction | 23 | 2 | TTG | TGA | riboCIRC,TransCirc | Yes |
chr12|111485270|111486824|2|60,59|0,1495 | circATXN2(S1L,S3S).A | ATXN2 | LNPNAKEFNPRSFSLYPIPMTPMPVNQAKTYRAGKLGNQH | SFSLYPIPMTPMPVNQAK | No | Alternative | Junction | 18 | 2 | TTG | TGA | riboCIRC,TransCirc | Yes |
chr12|111485270|111486824|3|36,94,64|0,501,1490 | circATXN2(S1L,NE,S3L) | ATXN2 | MQRSSTHVPSLSQSLLLPQLHLGLKHNLAHLWWVINSQLQFILPCQ | HNLAHLWWVINSQLQFILPCQ | No | Alternative | Junction | 21 | 2 | ATG | TGA | riboCIRC | Yes |
chr12|111485270|111486824|3|36,94,64|0,501,1490 | circATXN2(S1L,NE,S3L) | ATXN2 | MQRSSTHVPSLSQSLLLPQLHLGLKHNLAHLWWVINSQLQFILPCQ | SSTHVPSLSQSLLLPQLHLGLK | No | Alternative | Junction | 22 | 2 | ATG | TGA | riboCIRC | Yes |
Page 1 of 1
bottom of page