top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC25A45-1:1 | BRCA-Luminal B | 9 | 0.141575 | noncoding | 119 | chr11 | 65308986 | 65314137 | - | 0.9988 | lnc-SLC25A45-1 | 1 | -4.52 | -3.736 | -3.391 | 6 | noncoding | -0.360588708 | EMGEIQVPR | n[145]EM[147]GEIQVPR | LLSIYQVPSAVLVPGDSASGLGPAAQRREMGEIQVPRYIMIPFQVASPSWKLPSPAAIAPPWDLGDGVGSPLRQHWPDWRDQQGSSLLPPGRLKPALHGHETWNPGPWGAGEMTGTWGL |
lnc-SLC25A45-1:1 | BRCA-Basal-like | 9 | 0.141575 | noncoding | 119 | chr11 | 65308986 | 65314137 | - | 0.9988 | lnc-SLC25A45-1 | 1 | -4.52 | -3.736 | -3.391 | 6 | noncoding | -0.360588708 | EMGEIQVPR | n[145]EM[147]GEIQVPR | LLSIYQVPSAVLVPGDSASGLGPAAQRREMGEIQVPRYIMIPFQVASPSWKLPSPAAIAPPWDLGDGVGSPLRQHWPDWRDQQGSSLLPPGRLKPALHGHETWNPGPWGAGEMTGTWGL |
lnc-SLC25A47-5:1 | LUAD | 7 | 0.184639 | noncoding | 80 | chr14 | 100279375 | 100282787 | + | 0.9952 | lnc-SLC25A47-5 | 0.817 | 0 | 0 | 0 | 3 | noncoding | -0.338848888 | QHWDVLR | n[230]QHWDVLR | LIFHKVASLIKLTAFHETPRCCKKKKQHWDVLRRGQFAVLCSVCCSLWGPHNVRTHHGGEKGISTKRNNLFFLHCPYPDM |
lnc-SLC25A48-3:1 | OV | 8 | 0.176491 | noncoding | 85 | chr5 | 135559576 | 135634874 | + | 0.5126 | lnc-SLC25A48-3 | 1 | -4.348 | -3.395 | -4.681 | 1 | noncoding | -0.341973933 | HLGWECRK | n[145]HLGWECRK | MGQQPSLKKERRKKTLLDVGCTAKHLGWECRKQAWNARNAAPVAKLWSHRQILFKNLLHARPALCHRVKKKPSSHSHIGESHLSR |
lnc-SLC25A48-3:1 | OV | 10 | 0.176491 | noncoding | 85 | chr5 | 135559576 | 135634874 | + | 0.4884 | lnc-SLC25A48-3 | 1 | -4.348 | -3.395 | -4.681 | 1 | noncoding | -0.341973933 | TLLDVGCTAK | n[145]TLLDVGCTAK | MGQQPSLKKERRKKTLLDVGCTAKHLGWECRKQAWNARNAAPVAKLWSHRQILFKNLLHARPALCHRVKKKPSSHSHIGESHLSR |
Page 1 of 1
bottom of page