top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC43A1-1:1 | OV | 21 | 0.199151 | noncoding | 101 | chr11 | 57476492 | 57477534 | - | 0.6606 | lnc-SLC43A1-1 | 1 | 3.941 | 12.289 | -2.806 | 1 | noncoding | -0.311144585 | MARTGEGRAEPPHTPSWGCHK | n[145]M[147]ARTGEGRAEPPHTPSWGCHK | MARTGEGRAEPPHTPSWGCHKSGQPRGQARRGGLLPGEERSWEGKGRQQGQGRWLEELLPRARLPGRVGAAGGHAWKSASRSARRSRPWRSGGVAQVTSEL |
lnc-SLC43A1-1:1 | OV | 15 | 0.199151 | noncoding | 85 | chr11 | 57476492 | 57477534 | - | 0.2741 | lnc-SLC43A1-1 | 1 | 3.941 | 12.289 | -2.806 | 2 | noncoding | -0.311144585 | VVGGAVAAGAAARPR | n[145]VVGGAVAAGAAARPR | LGLPQVRTAQGAGKERRPAPRGGEELGGEREAARPGKVVGGAVAAGAAARPRGCRGRTRLEVGLAERAQVSALALRGGGAGHVGA |
lnc-SLC44A3-1:5 | CCRC | 8 | 0.0691998 | noncoding | 44 | chr1 | 94927424 | 94963247 | + | 0.9975 | lnc-SLC44A3-1 | 0.12 | -3.1 | -4.748 | -6.242 | 11 | noncoding | -0.350714989 | GEKAETLR | n[230]GEKAETLR | LRGEKAETLRLKNPGRGQPPPKLHLLPPLSGAHLGQISIPEIPG |
lnc-SLC44A3-1:5 | HCC | 8 | 0.0691998 | noncoding | 44 | chr1 | 94927424 | 94963247 | + | 0.9981 | lnc-SLC44A3-1 | 0.12 | -3.1 | -4.748 | -6.242 | 36 | noncoding | -0.350714989 | GEKAETLR | n[230]GEKAETLR | LRGEKAETLRLKNPGRGQPPPKLHLLPPLSGAHLGQISIPEIPG |
lnc-SLC44A3-1:5 | LUAD | 8 | 0.0691998 | noncoding | 44 | chr1 | 94927424 | 94963247 | + | 0.9982 | lnc-SLC44A3-1 | 0.12 | -3.1 | -4.748 | -6.242 | 22 | noncoding | -0.350714989 | GEKAETLR | n[230]GEKAETLR | LRGEKAETLRLKNPGRGQPPPKLHLLPPLSGAHLGQISIPEIPG |
Page 1 of 1
bottom of page