top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SOX30-3:2 | BRCA-Basal-like | 9 | 0.178342 | noncoding | 77 | chr5 | 157711732 | 157731684 | - | 0.9979 | lnc-SOX30-3 | 0.793 | 0 | 0 | 0 | 88 | noncoding | -0.303205313 | LLLPPPVLR | n[145]LLLPPPVLR | LLLPPPVLRQISLTRFLKIIFYLLVLTYWQKQSVSPLVPRSKSYPNLKKKKKKKILFLVFEGVAVMFPLFLVAFINL |
lnc-SOX30-3:2 | BRCA-Luminal A | 9 | 0.178342 | noncoding | 77 | chr5 | 157711732 | 157731684 | - | 0.9979 | lnc-SOX30-3 | 0.793 | 0 | 0 | 0 | 88 | noncoding | -0.303205313 | LLLPPPVLR | n[145]LLLPPPVLR | LLLPPPVLRQISLTRFLKIIFYLLVLTYWQKQSVSPLVPRSKSYPNLKKKKKKKILFLVFEGVAVMFPLFLVAFINL |
lnc-SOX30-3:2 | HCC | 7 | 0.178342 | noncoding | 67 | chr5 | 157711732 | 157731684 | - | 1 | lnc-SOX30-3 | 0.128 | 0 | 0 | 0 | 25 | noncoding | -0.303205313 | QSLQQAK | n[230]QSLQQAK | LLEPGRQSLQQAKIVPLHSSLANRATLSQKKKKKKKNRKGKWGLFQNKRFKRHNNQIQCKTLDWILA |
lnc-SOX30-3:2 | HCC | 7 | 0.178342 | noncoding | 67 | chr5 | 157711732 | 157731684 | - | 1 | lnc-SOX30-3 | 0.128 | 0 | 0 | 0 | 25 | noncoding | -0.303205313 | QSLQQAK | QSLQQAK | LLEPGRQSLQQAKIVPLHSSLANRATLSQKKKKKKKNRKGKWGLFQNKRFKRHNNQIQCKTLDWILA |
lnc-SOX30-3:2 | LUAD | 7 | 0.178342 | noncoding | 67 | chr5 | 157711732 | 157731684 | - | 0.9993 | lnc-SOX30-3 | 0.128 | 0 | 0 | 0 | 18 | noncoding | -0.303205313 | QSLQQAK | n[230]QSLQQAK | LLEPGRQSLQQAKIVPLHSSLANRATLSQKKKKKKKNRKGKWGLFQNKRFKRHNNQIQCKTLDWILA |
Page 1 of 1
bottom of page