top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SPEN-3:1 | LUAD | 7 | 0.0735757 | noncoding | 76 | chr1 | 15835166 | 15836877 | + | 0.9973 | lnc-SPEN-3 | 1 | -3.627 | -0.793 | -2.746 | 24 | noncoding | -0.311006863 | GALGFFR | n[230]GALGFFR | LLGPWLEGWRCRGALGFFRFLSNACFLALPTPQRPFGSIFPETSLRNSAKSIQFRHCFPLRACARRQAESLWRAGV |
lnc-SPEN-3:1 | OV | 7 | 0.0735757 | noncoding | 76 | chr1 | 15835166 | 15836877 | + | 0.9222 | lnc-SPEN-3 | 1 | -3.627 | -0.793 | -2.746 | 3 | noncoding | -0.311006863 | GALGFFR | n[145]GALGFFR | LLGPWLEGWRCRGALGFFRFLSNACFLALPTPQRPFGSIFPETSLRNSAKSIQFRHCFPLRACARRQAESLWRAGV |
lnc-SPEN-3:1 | OV | 15 | 0.0735757 | noncoding | 76 | chr1 | 15835166 | 15836877 | + | 0.1068 | lnc-SPEN-3 | 1 | -3.627 | -0.793 | -2.746 | 1 | noncoding | -0.311006863 | SIQFRHCFPLRACAR | n[145]SIQFRHCFPLRACAR | LLGPWLEGWRCRGALGFFRFLSNACFLALPTPQRPFGSIFPETSLRNSAKSIQFRHCFPLRACARRQAESLWRAGV |
lnc-SPERT-3:1 | BRCA-HER2-enriched | 11 | 0.0926019 | noncoding | 104 | chr13 | 45671844 | 45672391 | + | 0.9987 | lnc-SPERT-3 | 1 | 0 | 0 | 0 | 2 | noncoding | -0.336950448 | ASWSNLSMDEK | n[145]ASWSNLSM[147]DEK | LYLLKQSKANHKEWLLTPLPDVAYLSPLSASQEDLKEKEKASWSNLSMDEKVELCCIQFNRSFSGINRGMKKWKMVVGTAMFFGFTALVLIREKHCVWSHPTRL |
lnc-SPERT-3:1 | BRCA-Luminal A | 11 | 0.0926019 | noncoding | 104 | chr13 | 45671844 | 45672391 | + | 0.9987 | lnc-SPERT-3 | 1 | 0 | 0 | 0 | 2 | noncoding | -0.336950448 | ASWSNLSMDEK | n[145]ASWSNLSM[147]DEK | LYLLKQSKANHKEWLLTPLPDVAYLSPLSASQEDLKEKEKASWSNLSMDEKVELCCIQFNRSFSGINRGMKKWKMVVGTAMFFGFTALVLIREKHCVWSHPTRL |
Page 1 of 1
bottom of page