top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SPNS2-4:1 | OSCC | 13 | 0.0198448 | noncoding | 72 | chr17 | 4555502 | 4556542 | + | 0.7628 | lnc-SPNS2-4 | 0.177 | -3.448 | -2.761 | -3.781 | 2 | noncoding | -0.353257311 | SLVSLMQGQAWIR | n[145]SLVSLM[147]QGQAWIR | LSDKKGPPPPYSCKDLRGRNPKPCNYRDPGLEGLRLARSKAAWGPGLGFHSEGDGKSLVSLMQGQAWIRFTF |
lnc-SPNS3-1:10 | PRAD | 28 | 0.120253 | noncoding | 34 | chr17 | 4159800 | 4160702 | + | 0.968 | lnc-SPNS3-1 | 0.515 | 0 | 0 | 0 | 3 | noncoding | -0.337655358 | MYPYIHMTELCTPIIHDCPYPYIHMTQR | MYPYIHMTELCTPIIHDCPYPYIHM[147]TQR | MYPYIHMTELCTPIIHDCPYPYIHMTQRRTPIST |
lnc-SPNS3-1:10 | PRAD | 27 | 0.120253 | noncoding | 34 | chr17 | 4159800 | 4160702 | + | 0.2995 | lnc-SPNS3-1 | 0.515 | 0 | 0 | 0 | 2 | noncoding | -0.337655358 | YPYIHMTELCTPIIHDCPYPYIHMTQR | YPYIHMTELCTPIIHDCPYPYIHMTQR | MYPYIHMTELCTPIIHDCPYPYIHMTQRRTPIST |
lnc-SPNS3-2:2 | OV | 12 | 0.053163 | noncoding | 54 | chr17 | 4163909 | 4164713 | + | 0.993 | lnc-SPNS3-2 | 0.995 | -3.371 | -3.375 | -3.797 | 21 | noncoding | -0.413730635 | DVVTANSTHLPK | n[145]DVVTANSTHLPK | MCACSFCPATAPPLGSHRDVVTANSTHLPKKSKSSRRAVSTQDSLAAENQCCQL |
lnc-SPOCD1-4:2 | BRCA-Luminal A | 12 | 0.363691 | noncoding | 133 | chr1 | 31785242 | 31788606 | - | 0.7141 | lnc-SPOCD1-4 | 0.983 | -3.73 | -1.591 | -3.398 | 1 | noncoding | -0.327442335 | DSSVSTCVGGNK | n[145]DSSVSTCVGGNK | LRCLGWSRTGMEGRLRAETAWRATCLFLYQRGLGNPGATPLPFLSLSFPVVGSKDSSVSTCVGGNKSAQYGEPSRCCSYVTVPWREFPVLCTVQAEAERDPLSVLDRSSRIPGGSCSFKNWGWLLSCVEEDCW |
Page 1 of 1
bottom of page