top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SRGAP2C-5:1 | HCC | 11 | 0.153303 | noncoding | 100 | chr1 | 121396753 | 121463129 | + | 0.9063 | lnc-SRGAP2C-5 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.272690797 | VALPVEAVGEK | VALPVEAVGEK | LHRVALPVEAVGEKKEGGGGGDAAATEGGTGAAASRALQQCGQLQKLIVIFIGSLCGLCTKCAVSNDLTQQEIQTLELGDDILIYEMQEDVMCGTSMKTD |
lnc-SRP54-1:3 | OV | 17 | 0.0156144 | noncoding | 115 | chr14 | 34874992 | 34877064 | + | 0.9771 | lnc-SRP54-1 | 1 | 0.001 | -0.432 | 2.59 | 15 | noncoding | -0.317976976 | GELRPTATSPPLGAPGK | n[145]GELRPTATSPPLGAPGK | LAGRPAQRRQSARRGRTPELLRFVPGSPPLPRRRRPAPERPSPAITPTATCPPSPLQRQRGETPSSQGTASLRPRRAPGCRFSRCHCPTPRGELRPTATSPPLGAPGKFLIYFRL |
lnc-SRP54-6:1 | OV | 14 | 0.437444 | noncoding | 59 | chr14 | 34694169 | 34694644 | + | 0.9197 | lnc-SRP54-6 | 1 | 0 | 0 | 0 | 2 | coding | 0.691336619 | IEDNTTLVFTVDVK | n[145]IEDNTTLVFTVDVK | LWTTESAMKKIEDNTTLVFTVDVKANKQQIKQAVKKLCDIDAAKVNTLIRPGGEKKAYV |
lnc-SRP54-6:1 | OV | 8 | 0.437444 | noncoding | 59 | chr14 | 34694169 | 34694644 | + | 0.9896 | lnc-SRP54-6 | 1 | 0 | 0 | 0 | 36 | coding | 0.691336619 | LCDIDAAK | n[145]LCDIDAAK | LWTTESAMKKIEDNTTLVFTVDVKANKQQIKQAVKKLCDIDAAKVNTLIRPGGEKKAYV |
lnc-SRP9-1:1 | BRCA-HER2-enriched | 7 | 0.345825 | noncoding | 37 | chr1 | 225700603 | 225752243 | + | 0.9957 | lnc-SRP9-1 | 1 | -2.114 | 1.197 | -1.756 | 33 | noncoding | -0.369318675 | DRAYLSR | n[145]DRAYLSR | LMWCSISAFSMKPRLRPSPFRKQRTRDRAYLSRYSSW |
Page 1 of 1
bottom of page