top of page

The Maher Lab

McDonnell Genome Institute

Washington University School of Medicine in St. Louis

PepTransDB

The Maher Lab | Washington University

LncRNA Peptides

CircRNA Peptides

lncRNA Peptides

Use criteria below to search among 19,871 unique lncRNA peptides:

*Click Transcript to view full ORF and comprehensive information in new page.

Transcript*	Cancer	Peptide Length	CPC Coding Probability	CPC Label	ORF Length	Chromosome	Start	End	Strand	Max Probability	Gene Name	Conservation Score	PhyloCSF Frame 1	PhyloCSF Frame 2	PhyloCSF Frame 3	No. of Spectra	CNTI Index	CNTI Score	Peptide	Modified Peptide	ORF
SNAI3-AS1:21	BRCA-Luminal A	13	0.380599	noncoding	88	chr16	88663364	88677751	+	0.9999	SNAI3-AS1	0.015	-3.373	-4.576	-3.757	29	noncoding	-0.282565964	RVDVMSEDLGGER	n[145]RVDVM[147]SEDLGGER	LLRGPQIYPAQDWEMGGDQDPQGFPRLPPSPRHHWTVTETPASSVLRSCSLLSILAPPPARRKDSDTAPGRGRRVDVMSEDLGGERKA
SNAI3-AS1:21	BRCA-HER2-enriched	13	0.380599	noncoding	88	chr16	88663364	88677751	+	0.9999	SNAI3-AS1	0.015	-3.373	-4.576	-3.757	29	noncoding	-0.282565964	RVDVMSEDLGGER	n[145]RVDVMSEDLGGER	LLRGPQIYPAQDWEMGGDQDPQGFPRLPPSPRHHWTVTETPASSVLRSCSLLSILAPPPARRKDSDTAPGRGRRVDVMSEDLGGERKA
SNAI3-AS1:21	BRCA-Basal-like	13	0.380599	noncoding	88	chr16	88663364	88677751	+	0.9999	SNAI3-AS1	0.015	-3.373	-4.576	-3.757	29	noncoding	-0.282565964	RVDVMSEDLGGER	n[145]RVDVMSEDLGGER	LLRGPQIYPAQDWEMGGDQDPQGFPRLPPSPRHHWTVTETPASSVLRSCSLLSILAPPPARRKDSDTAPGRGRRVDVMSEDLGGERKA
SNAI3-AS1:21	BRCA-Luminal B	13	0.380599	noncoding	88	chr16	88663364	88677751	+	0.9999	SNAI3-AS1	0.015	-3.373	-4.576	-3.757	29	noncoding	-0.282565964	RVDVMSEDLGGER	n[145]RVDVMSEDLGGER	LLRGPQIYPAQDWEMGGDQDPQGFPRLPPSPRHHWTVTETPASSVLRSCSLLSILAPPPARRKDSDTAPGRGRRVDVMSEDLGGERKA
SNAI3-AS1:21	BRCA-Luminal A	13	0.380599	noncoding	88	chr16	88663364	88677751	+	0.9999	SNAI3-AS1	0.015	-3.373	-4.576	-3.757	29	noncoding	-0.282565964	RVDVMSEDLGGER	n[145]RVDVMSEDLGGER	LLRGPQIYPAQDWEMGGDQDPQGFPRLPPSPRHHWTVTETPASSVLRSCSLLSILAPPPARRKDSDTAPGRGRRVDVMSEDLGGERKA

Page 1 of 1

bottom of page