top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TFB1M-1:1 | BRCA-Luminal B | 11 | 0.271922 | noncoding | 42 | chr6 | 155253138 | 155256724 | - | 0.91 | lnc-TFB1M-1 | 0.023 | -4.062 | -5.108 | -2.288 | 3 | noncoding | -0.351707274 | SYIWTMSAGRK | n[145]SYIWTMSAGRK | MHILVEETKSYIWTMSAGRKTRDWGLGVAVFYSRTSGSKRHV |
lnc-TFB1M-1:1 | BRCA-Basal-like | 11 | 0.271922 | noncoding | 42 | chr6 | 155253138 | 155256724 | - | 0.91 | lnc-TFB1M-1 | 0.023 | -4.062 | -5.108 | -2.288 | 3 | noncoding | -0.351707274 | SYIWTMSAGRK | n[145]SYIWTMSAGRK | MHILVEETKSYIWTMSAGRKTRDWGLGVAVFYSRTSGSKRHV |
lnc-TFB1M-1:1 | OV | 10 | 0.271922 | noncoding | 42 | chr6 | 155253138 | 155256724 | - | 0.8651 | lnc-TFB1M-1 | 0.023 | -4.062 | -5.108 | -2.288 | 3 | noncoding | -0.351707274 | SYIWTMSAGR | n[145]SYIWTM[147]SAGR | MHILVEETKSYIWTMSAGRKTRDWGLGVAVFYSRTSGSKRHV |
lnc-TFB1M-2:1 | BRCA-Basal-like | 16 | 0.10269 | noncoding | 56 | chr6 | 155326844 | 155328708 | - | 0.995 | lnc-TFB1M-2 | 0.411 | -3.2 | -4.038 | -4.727 | 1 | noncoding | -0.376849125 | LCFSLNITFSRDRGGR | n[145]LCFSLNITFSRDRGGR | MPSGALVGKLCFSLNITFSRDRGGRHYDQRTFILCIPPNARLFPEKWPSTQCRGNG |
lnc-TFCP2-4:1 | BRCA-HER2-enriched | 17 | 0.0903965 | noncoding | 97 | chr12 | 51198639 | 51217667 | - | 1 | lnc-TFCP2-4 | 1 | 9.914 | 1.923 | 5.313 | 2 | noncoding | -0.287072297 | VLEVGVDAQLPAEEESK | n[145]VLEVGVDAQLPAEEESK | MDPGAGSETSLTVNEQVIVMSGHETIRVLEVGVDAQLPAEEESKGLEGVAAEGSQSGDPAEASQAAGEAGPDNLGSSAEATVLQVKWLVSRGWPCGQ |
Page 1 of 1
bottom of page