top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TFEC-7:1 | OV | 13 | 0.0659979 | noncoding | 123 | chr7 | 116209233 | 116211511 | - | 0.9281 | lnc-TFEC-7 | 1 | 0.314 | 3.938 | -2.906 | 2 | noncoding | -0.267119079 | LASGSAANTGNLR | n[145]LASGSAANTGNLR | LASGSAANTGNLRNSRGAAQQPLARRRRTSAAQSAAAGLRPGPGNKGGRAANGSRAAPGRRQSPSAARTFAARARRWQGERRGGVRGGALLGKLSDPDLVSEGILWASTGRLLKSWDPQPPSS |
lnc-TFEC-7:1 | OV | 16 | 0.0659979 | noncoding | 123 | chr7 | 116209233 | 116211511 | - | 0.1184 | lnc-TFEC-7 | 1 | 0.314 | 3.938 | -2.906 | 1 | noncoding | -0.267119079 | LASGSAANTGNLRNSR | n[145]LASGSAANTGNLRNSR | LASGSAANTGNLRNSRGAAQQPLARRRRTSAAQSAAAGLRPGPGNKGGRAANGSRAAPGRRQSPSAARTFAARARRWQGERRGGVRGGALLGKLSDPDLVSEGILWASTGRLLKSWDPQPPSS |
lnc-TGFA-1:1 | OV | 11 | 0.232594 | noncoding | 112 | chr2 | 70401994 | 70403798 | - | 0.9785 | lnc-TGFA-1 | 0.462 | 0 | 0 | 0 | 40 | noncoding | -0.363772342 | LLQLLCGMGVK | n[145]LLQLLCGMGVK | LLQLLCGMGVKFPGQSSCVPRRIMAASAESCRLSGKWGKASSHRPHPAPMQSKGPFSLPPCPLSATALSLFSDSGQAGLRTCPMLPTFQLQKKRALVLPAPVESTCRICALP |
lnc-TGFA-2:1 | BRCA-Luminal B | 7 | 0.106461 | noncoding | 44 | chr2 | 70656783 | 70658325 | - | 0.996 | lnc-TGFA-2 | 0.427 | -3.632 | -3.476 | -5.508 | 5 | noncoding | -0.395552015 | AEWPHLK | n[145]AEWPHLK | MAIGPRAEWPHLKHIIKWEYISGNPTPTLPLHLTPVGPALWVID |
lnc-TGFA-2:1 | BRCA-HER2-enriched | 7 | 0.106461 | noncoding | 44 | chr2 | 70656783 | 70658325 | - | 0.996 | lnc-TGFA-2 | 0.427 | -3.632 | -3.476 | -5.508 | 5 | noncoding | -0.395552015 | AEWPHLK | n[145]AEWPHLK | MAIGPRAEWPHLKHIIKWEYISGNPTPTLPLHLTPVGPALWVID |
Page 1 of 1
bottom of page