top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TMEM106C-3:1 | BRCA-HER2-enriched | 24 | 0.149592 | noncoding | 85 | chr12 | 47905104 | 47907598 | + | 0.7253 | lnc-TMEM106C-3 | 0.968 | 0 | 0 | 1.986 | 2 | noncoding | -0.304977514 | ELSLSFPGPWSRVPPSPPAPWHRR | n[145]ELSLSFPGPWSRVPPSPPAPWHRR | LLLLQNARKLSLIPQIRVKYPGGPKWKPELRHCSHPISPWQRPRLTTFPACRESHPRELSLSFPGPWSRVPPSPPAPWHRREGKR |
lnc-TMEM106C-3:1 | BRCA-Luminal B | 9 | 0.149592 | noncoding | 85 | chr12 | 47905104 | 47907598 | + | 0.9995 | lnc-TMEM106C-3 | 0.968 | 0 | 0 | 1.986 | 37 | noncoding | -0.304977514 | KLSLIPQIR | n[145]KLSLIPQIR | LLLLQNARKLSLIPQIRVKYPGGPKWKPELRHCSHPISPWQRPRLTTFPACRESHPRELSLSFPGPWSRVPPSPPAPWHRREGKR |
lnc-TMEM106C-3:1 | BRCA-Basal-like | 9 | 0.149592 | noncoding | 85 | chr12 | 47905104 | 47907598 | + | 0.9995 | lnc-TMEM106C-3 | 0.968 | 0 | 0 | 1.986 | 37 | noncoding | -0.304977514 | KLSLIPQIR | n[145]KLSLIPQIR | LLLLQNARKLSLIPQIRVKYPGGPKWKPELRHCSHPISPWQRPRLTTFPACRESHPRELSLSFPGPWSRVPPSPPAPWHRREGKR |
lnc-TMEM106C-3:1 | BRCA-Luminal A | 9 | 0.149592 | noncoding | 85 | chr12 | 47905104 | 47907598 | + | 0.9995 | lnc-TMEM106C-3 | 0.968 | 0 | 0 | 1.986 | 37 | noncoding | -0.304977514 | KLSLIPQIR | n[145]KLSLIPQIR | LLLLQNARKLSLIPQIRVKYPGGPKWKPELRHCSHPISPWQRPRLTTFPACRESHPRELSLSFPGPWSRVPPSPPAPWHRREGKR |
lnc-TMEM106C-3:1 | BRCA-HER2-enriched | 9 | 0.149592 | noncoding | 85 | chr12 | 47905104 | 47907598 | + | 0.9995 | lnc-TMEM106C-3 | 0.968 | 0 | 0 | 1.986 | 37 | noncoding | -0.304977514 | KLSLIPQIR | n[145]KLSLIPQIR | LLLLQNARKLSLIPQIRVKYPGGPKWKPELRHCSHPISPWQRPRLTTFPACRESHPRELSLSFPGPWSRVPPSPPAPWHRREGKR |
Page 1 of 1
bottom of page