top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TMPRSS15-22:1 | OV | 9 | 0.0218563 | noncoding | 66 | chr21 | 20576916 | 20608207 | - | 0.9966 | lnc-TMPRSS15-22 | 0.356 | -5.694 | -5.637 | -5.753 | 3 | noncoding | -0.516830098 | NIFSEVNFK | n[145]NIFSEVNFK | LILYPETVLDCVCVCVLVLQHNIPSTLFQTQKQESKNIFSEVNFKKNVNGSHFAEILSINSALLRL |
lnc-TMPRSS2-83:1 | BRCA-Basal-like | 16 | 0.7349 | coding | 128 | chr21 | 41141497 | 41237583 | - | 0.9959 | lnc-TMPRSS2-83 | 0.208 | -4.285 | -3.337 | -3.005 | 16 | coding | 0.687851006 | VTGEVLTWPAESLAMP | n[145]VTGEVLTWPAESLAM[147]P | LVDLTISVDSSSIRSGQAMPEVIPRASFPSWPTSSHQEVPRAPPSGSGPHRPTPHLLQGVCGGPHHCHPLLVLTGVPASFLGLLPTSSHHSPITVKSEGVSPPPPMALTSPRVTGEVLTWPAESLAMP |
lnc-TMPRSS2-83:1 | BRCA-Luminal A | 16 | 0.7349 | coding | 128 | chr21 | 41141497 | 41237583 | - | 0.9959 | lnc-TMPRSS2-83 | 0.208 | -4.285 | -3.337 | -3.005 | 16 | coding | 0.687851006 | VTGEVLTWPAESLAMP | n[145]VTGEVLTWPAESLAM[147]P | LVDLTISVDSSSIRSGQAMPEVIPRASFPSWPTSSHQEVPRAPPSGSGPHRPTPHLLQGVCGGPHHCHPLLVLTGVPASFLGLLPTSSHHSPITVKSEGVSPPPPMALTSPRVTGEVLTWPAESLAMP |
lnc-TMPRSS2-83:1 | BRCA-Luminal B | 16 | 0.7349 | coding | 128 | chr21 | 41141497 | 41237583 | - | 0.9959 | lnc-TMPRSS2-83 | 0.208 | -4.285 | -3.337 | -3.005 | 16 | coding | 0.687851006 | VTGEVLTWPAESLAMP | n[145]VTGEVLTWPAESLAM[147]P | LVDLTISVDSSSIRSGQAMPEVIPRASFPSWPTSSHQEVPRAPPSGSGPHRPTPHLLQGVCGGPHHCHPLLVLTGVPASFLGLLPTSSHHSPITVKSEGVSPPPPMALTSPRVTGEVLTWPAESLAMP |
lnc-TMPRSS2-83:1 | BRCA-HER2-enriched | 16 | 0.7349 | coding | 128 | chr21 | 41141497 | 41237583 | - | 0.9959 | lnc-TMPRSS2-83 | 0.208 | -4.285 | -3.337 | -3.005 | 16 | coding | 0.687851006 | VTGEVLTWPAESLAMP | n[145]VTGEVLTWPAESLAM[147]P | LVDLTISVDSSSIRSGQAMPEVIPRASFPSWPTSSHQEVPRAPPSGSGPHRPTPHLLQGVCGGPHHCHPLLVLTGVPASFLGLLPTSSHHSPITVKSEGVSPPPPMALTSPRVTGEVLTWPAESLAMP |
Page 1 of 1
bottom of page