top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TSNAX-2:1 | OV | 9 | 0.0164821 | noncoding | 40 | chr1 | 231693461 | 231693718 | + | 0.9455 | lnc-TSNAX-2 | 0.176 | -5.732 | -4.164 | -3.847 | 51 | noncoding | -0.395105345 | MLEGSGAAK | n[145]MLEGSGAAK | MRVLRCHKRPTGKMLEGSGAAKVVFMLTCWHSVQQCQLLC |
lnc-TSPAN11-4:1 | OV | 13 | 0.244052 | noncoding | 86 | chr12 | 30320833 | 30321617 | + | 0.3202 | lnc-TSPAN11-4 | 0.187 | 0 | 0 | 0 | 1 | noncoding | -0.372591423 | IDGSVLGVRQDSK | n[145]IDGSVLGVRQDSK | MKISGAMATSPTALNVKTFSHFRFTPNLKIFSHVWSNSLVFASPNNRSQQGAPKSGRPGRPGLAAAYLKIDGSVLGVRQDSKYSEI |
lnc-TSPAN11-4:1 | OV | 18 | 0.244052 | noncoding | 86 | chr12 | 30320833 | 30321617 | + | 0.8386 | lnc-TSPAN11-4 | 0.187 | 0 | 0 | 0 | 1 | noncoding | -0.372591423 | IFSHVWSNSLVFASPNNR | n[145]IFSHVWSNSLVFASPNNR | MKISGAMATSPTALNVKTFSHFRFTPNLKIFSHVWSNSLVFASPNNRSQQGAPKSGRPGRPGLAAAYLKIDGSVLGVRQDSKYSEI |
lnc-TSPAN11-5:1 | LUAD | 7 | 0.0364386 | noncoding | 39 | chr12 | 30200982 | 30217916 | + | 0.9998 | lnc-TSPAN11-5 | 0.439 | -5.159 | -4.349 | -3.345 | 13 | noncoding | -0.365234323 | GGTMVEK | n[230]GGTMVEK | MVLPDAQFGRLVRGGTMVEKKHSFLVFPNCGYDHKGDHL |
lnc-TSPAN11-5:1 | OV | 7 | 0.0364386 | noncoding | 39 | chr12 | 30200982 | 30217916 | + | 0.9104 | lnc-TSPAN11-5 | 0.439 | -5.159 | -4.349 | -3.345 | 6 | noncoding | -0.365234323 | GGTMVEK | n[145]GGTMVEK | MVLPDAQFGRLVRGGTMVEKKHSFLVFPNCGYDHKGDHL |
Page 1 of 1
bottom of page