top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-UPF3A-1:1 | CCRC | 7 | 0.0135017 | noncoding | 70 | chr13 | 114306645 | 114307066 | + | 0.9973 | lnc-UPF3A-1 | 0.404 | 0 | 0 | 0 | 34 | noncoding | -0.346192096 | MGPGSLR | n[230]M[147]GPGSLR | LCHTHRLCSCLLVLLDIKGRLVVCFINEPQLQVDFHTRMNEDSDITFHFQVFFGRCVVMNSVRMGPGSLR |
lnc-UPF3A-1:1 | OV | 7 | 0.0135017 | noncoding | 70 | chr13 | 114306645 | 114307066 | + | 0.99 | lnc-UPF3A-1 | 0.404 | 0 | 0 | 0 | 9 | noncoding | -0.346192096 | MGPGSLR | n[145]MGPGSLR | LCHTHRLCSCLLVLLDIKGRLVVCFINEPQLQVDFHTRMNEDSDITFHFQVFFGRCVVMNSVRMGPGSLR |
lnc-UPF3A-1:1 | OV | 7 | 0.0135017 | noncoding | 70 | chr13 | 114306645 | 114307066 | + | 0.99 | lnc-UPF3A-1 | 0.404 | 0 | 0 | 0 | 9 | noncoding | -0.346192096 | MGPGSLR | n[145]M[147]GPGSLR | LCHTHRLCSCLLVLLDIKGRLVVCFINEPQLQVDFHTRMNEDSDITFHFQVFFGRCVVMNSVRMGPGSLR |
lnc-UPK1B-2:1 | CRC | 15 | 0.0373223 | noncoding | 86 | chr3 | 119298664 | 119299012 | + | 0.7903 | lnc-UPK1B-2 | 1 | 0 | 0 | 0 | 6 | noncoding | -0.335342756 | DISEASVFTAYILPK | LTKKRRGDDCAKKGCSHVQPVRCTICAQCLPKDKAIKKFLIQNTVEATAVRDISEASVFTAYILPKLYVKLHYCVSCAIHSKVVRN | |
lnc-UPK1B-2:1 | EOGC | 15 | 0.0373223 | noncoding | 86 | chr3 | 119298664 | 119299012 | + | 0.8509 | lnc-UPK1B-2 | 1 | 0 | 0 | 0 | 26 | noncoding | -0.335342756 | DISEASVFTAYILPK | n[145]DISEASVFTAYILPK | LTKKRRGDDCAKKGCSHVQPVRCTICAQCLPKDKAIKKFLIQNTVEATAVRDISEASVFTAYILPKLYVKLHYCVSCAIHSKVVRN |
Page 1 of 1
bottom of page