top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-VCAM1-2:1 | EOGC | 9 | 0.276687 | noncoding | 80 | chr1 | 100651946 | 100652267 | + | 0.5811 | lnc-VCAM1-2 | 1 | -4.215 | -4.634 | -2.557 | 56 | noncoding | -0.365226095 | LECVQPNCR | n[145]LECVQPNCR | MVNISKTRRTSCKKCGKHQSHKVMQCKKGKDFLYAQEKWYYDRKQSGYGGQTKLISQKKAKTTKKIVLRLECVQPNCRSK |
lnc-VCAM1-3:1 | LUAD | 13 | 0.0343941 | noncoding | 45 | chr1 | 100923140 | 100939576 | + | 0.999 | lnc-VCAM1-3 | 0.26 | 0 | 0 | 0 | 2 | noncoding | -0.429511473 | LFFCQAAEVVIVK | n[43]LFFCQAAEVVIVK | MLFFCQAAEVVIVKWEGSNRELTNLLDQLSQSLSNNSQFTLHLSP |
lnc-VCAN-1:18 | OV | 16 | 0.0614912 | noncoding | 49 | chr5 | 84384721 | 84550423 | + | 0.8156 | lnc-VCAN-1 | 0.172 | 0 | 0 | 0 | 8 | coding | 0.578308726 | LAVPLCVLLSCLLPSK | n[145]LAVPLCVLLSCLLPSK | LAVPLCVLLSCLLPSKTYLASPLPSAVIVSFLRPSQPCGTVSQLNLPSL |
lnc-VCAN-1:7 | HCC | 9 | 0.0305825 | noncoding | 63 | chr5 | 84382397 | 84392411 | + | 0.9977 | lnc-VCAN-1 | 0.974 | -5.88 | -5.457 | -4.73 | 10 | coding | 0.629222092 | IESEIYLFK | n[230]IESEIYLFK | MIKSSTPTIAGVMWLSREKRIIIGQRTVLDYFPFYLVFIAIFFSFPPFITLLKIESEIYLFKI |
lnc-VCAN-4:1 | OV | 9 | 0.048222 | noncoding | 41 | chr5 | 83201228 | 83202141 | + | 1 | lnc-VCAN-4 | 1 | -4.357 | -3.031 | -5.022 | 15 | noncoding | -0.394933456 | EAAEQDIEK | n[145]EAAEQDIEK | MKYLYEGESQSHHQGGRELNAWLFGLWAKRTKEAAEQDIEK |
Page 1 of 1
bottom of page