top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-VANGL1-18:3 | OV | 8 | 0.0627722 | noncoding | 33 | chr1 | 115505542 | 115562501 | + | 0.6789 | lnc-VANGL1-18 | 0.263 | 0 | 0 | 0 | 1 | noncoding | -0.323446803 | KDIDIIEK | n[145]KDIDIIEK | LNEKFKKDIDIIEKKQSSILKQKKSMNEIKKYN |
lnc-VAPA-1:1 | BRCA-Luminal B | 7 | 0.0167185 | noncoding | 45 | chr18 | 10017465 | 10020824 | + | 0.9998 | lnc-VAPA-1 | 0.865 | -4.729 | -4.883 | -5.773 | 34 | noncoding | -0.480918632 | QVSADLK | n[145]QVSADLK | LQLELEGKCISIEGRSVTVSRQVSADLKRIMSTGQWLRGRRRQIS |
lnc-VAPA-1:1 | BRCA-HER2-enriched | 7 | 0.0167185 | noncoding | 45 | chr18 | 10017465 | 10020824 | + | 0.9998 | lnc-VAPA-1 | 0.865 | -4.729 | -4.883 | -5.773 | 34 | noncoding | -0.480918632 | QVSADLK | n[145]QVSADLK | LQLELEGKCISIEGRSVTVSRQVSADLKRIMSTGQWLRGRRRQIS |
lnc-VAPA-1:1 | BRCA-Basal-like | 7 | 0.0167185 | noncoding | 45 | chr18 | 10017465 | 10020824 | + | 0.9998 | lnc-VAPA-1 | 0.865 | -4.729 | -4.883 | -5.773 | 34 | noncoding | -0.480918632 | QVSADLK | n[145]QVSADLK | LQLELEGKCISIEGRSVTVSRQVSADLKRIMSTGQWLRGRRRQIS |
lnc-VAPA-1:1 | BRCA-Luminal A | 7 | 0.0167185 | noncoding | 45 | chr18 | 10017465 | 10020824 | + | 0.9998 | lnc-VAPA-1 | 0.865 | -4.729 | -4.883 | -5.773 | 34 | noncoding | -0.480918632 | QVSADLK | n[145]QVSADLK | LQLELEGKCISIEGRSVTVSRQVSADLKRIMSTGQWLRGRRRQIS |
Page 1 of 1
bottom of page