top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|150957290|150959736|-|3|circRNA|KCNH2|NM_000238|5,4,3 | circKCNH2(5,4,3) | KCNH2 | MSLRRSPRELLPMSGGCGAREERGWGCHHVHPQFRGGDGEGHGGVPGS | ELLPMSGGCGAR | No | Alternative | Junction | 12 | 1 | ATG | TGA | TransCirc | No |
chr7|150957290|150959736|-|3|circRNA|KCNH2|NM_000238|5,4,3 | circKCNH2(5,4,3) | KCNH2 | MSLRRSPRELLPMSGGCGAREERGWGCHHVHPQFRGGDGEGHGGVPGS | ELLPMSGGCGAREER | No | Alternative | Junction | 15 | 1 | ATG | TGA | TransCirc | No |
chr7|150957290|150959736|-|3|circRNA|KCNH2|NM_000238|5,4,3 | circKCNH2(5,4,3) | KCNH2 | MSLRRSPRELLPMSGGCGAREERGWGCHHVHPQFRGGDGEGHGGVPGS | GWGCHHVHPQFR | No | Alternative | Junction | 12 | 1 | ATG | TGA | TransCirc | No |
chr7|151116792|151123886|+|8|circRNA|AGAP3|NM_001281300|2,3,4,5,6,7,8,9 | circAGAP3(2,3,4,5,6,7,8,9) | AGAP3 | LTWTGRRRLPSARWTASGAAAPSPSSRLVCEQPGVDAEPLRTGA | LTWTGRR | No | Alternative | Junction | 7 | 2 | CTG | TAA | TransCirc | No |
chr7|152094189|152110645|+|6|circRNA|GALNT11|NM_022087|2,3,4,5,6,7 | circGALNT11(2,3,4,5,6,7) | GALNT11 | MAGGLFAMNRQYFHELGQYDSGMDIWGGENLEISFREIDNGPSAMLGL | EIDNGPSAMLGL | No | Alternative | Junction | 12 | 2 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page