top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|58130740|58136168|+|5|circRNA|FLNB|ENST00000490882.5|25,26,27,28,29 | circFLNB(25,26,27,28,29) | FLNB | LESPTGVTTSHFLLIASEPHRRVMPASAWPRAAPSGFL | VMPASAWPRAAPSGFL | Yes | Junction | Junction | 16 | 2 | TTG | TGA | TransCirc | No |
chr3|58132807|58163330|+|18|circRNA|FLNB|ENST00000490882.5|27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44 | circFLNB(27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44) | FLNB | MLFASSLMRMVSTPSMSSSMGATWLEAPSKCALGSLDKRGTLPWCPPMARDSKGAPQAWWSQ | CALGSLDKR | No | Alternative | Junction | 9 | 1 | ATG | TGA | TransCirc | No |
chr3|58145920|58153641|+|7|circRNA|FLNB|ENST00000490882.5|34,35,36,37,38,39,40 | circFLNB(34,35,36,37,38,39,40) | FLNB | LRPVCAPGDGRAHGQRQVPWAARHRQPLPVHRGATW | QPLPVHR | No | Alternative | Alternative | 7 | 2 | CTG | TGA | TransCirc | No |
chr3|58145920|58153641|+|7|circRNA|FLNB|ENST00000490882.5|34,35,36,37,38,39,40 | circFLNB(34,35,36,37,38,39,40) | FLNB | LRQRLCPWGRTHTASGLCPRRWACTRSASSTVGSTSPAAPSSSPWGHLVKEAPTRCGQEALAWREEKRESQRAHSSST | LCPWGRTHTASGLCPR | No | Alternative | Junction | 16 | 1 | CTG | TGA | TransCirc | No |
chr3|58156075|58159544|+|1|ciRNA|FLNB|ENST00000490882.5|42 | ciFLNB(42) | FLNB | LNQDGLHKRPCRCTSLLSYIKNAEWLTCPLLSYVI | CTSLLSYIKNAEWLTCPLLSYVI | No | Alternative | Alternative | 23 | 1 | CTG | TAG | NA | No |
Page 1 of 1
bottom of page