top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr9|37424844|37432138|+|7|circRNA|GRHPR|ENST00000318158.10|2,3,4,5,6,7,8 | circGRHPR(2,3,4,5,6,7,8) | GRHPR | LYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCAVRWSSGTRMSPSLPRS | MSPSLPR | No | Alternative | Junction | 7 | 2 | CTG | TAG | TransCirc | No |
chr9|382512|399259|+|5|circRNA|DOCK8|ENST00000432829.6|22,23,24,25,26 | circDOCK8(22,23,24,25,26) | DOCK8 | MNISLAFFLYDLLSLMDRGFVFNLIRHYCSQALPLPS | HYCSQALPLPS | No | Junction | Junction | 11 | 1 | ATG | TAG | TransCirc | No |
chr9|38615593|38616044|-|2|circRNA|ANKRD18A|ENST00000607974.5|3,2 | circANKRD18A(3,2) | ANKRD18A | LYTARKRLVPSFSWNVAPIQTLRISTATLLSIMPCIIRGLHWQKDCFPTMQILKH | ISTATLLSIMPCIIRGLHWQK | No | Alternative | Alternative | 21 | 2 | CTG | TAA | TransCirc | No |
chr9|40993252|41011730|+|4|circRNA|RP11-87H9.2|TCONS_l2_00028793|2,3,4,5 | circRP11-87H9.2(2,3,4,5) | RP11-87H9.2 | LASVINRSFDIVRRDGKKVSRSELKPLPLRTLSRSLAS | LASVINR | No | Alternative | Alternative | 7 | 3 | CTG | TGA | NA | No |
chr9|41031370|41053899|-|6|circRNA|PGM5P2|ENST00000613141.1|7,6,5,4,3,2 | circPGM5P2(7,6,5,4,3,2) | PGM5P2 | MTQSPLDIIKLCLICGLHLHLDWMTDYWTEWHLVNTCGLLHYQEDQGSWWNHSNSQPLPWRTRGRVWSEV | MTQSPLDIIK | No | Alternative | Junction | 10 | 1 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page