top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr9|16435554|16437524|-|1|circRNA|BNC2|ENST00000380672.8|6 | circBNC2(6) | BNC2 | LKTKNLSGTMRTSLSLRSPNWARNPWKGMSTFTAK | NLSGTMRTSLSLR | No | Alternative | Alternative | 13 | 1 | CTG | TGA | TransCirc | No |
chr9|16435554|16437524|-|1|circRNA|BNC2|ENST00000380672.8|6 | circBNC2(6) | BNC2 | LVAMLHSPLAEAETGCCWQGAGPLGHHVSRRGNHHPSAVSAVWRNQIHCGADGNSGERRAGRGCTIFKDRLRYKDFH | AGRGCTIFK | No | Alternative | Junction | 9 | 2 | CTG | TGA | TransCirc | No |
chr9|17226202|17309252|+|6|circRNA|CNTLN|ENST00000380647.7|3,4,5,6,7,8 | circCNTLN(3,4,5,6,7,8) | CNTLN | MSYIFVLKPQNQMKLCSGKVLLIFRISYYKKSKKMLS | MSYIFVLKPQNQMKLCSGK | No | Alternative | Alternative | 19 | 2 | ATG | TAA | NA | No |
chr9|19063007|19076704|-|4|circRNA|HAUS6|NM_001270890|14,13,12,11 | circHAUS6(14,13,12,11) | HAUS6 | MKQFLRKYQNLKWKILHYQMLQRIQRVVHLEGLCQLKKVIHFKKSKIIW | ILHYQMLQR | No | Alternative | Alternative | 9 | 2 | ATG | TAG | TransCirc | No |
chr9|19070218|19093303|-|9|circRNA|HAUS6|NM_001270890|12,11,10,9,8,7,6,5,4 | circHAUS6(12,11,10,9,8,7,6,5,4) | HAUS6 | LGALHDLANRVNVEVAFLKLLVHYFFLLVVLSLFI | LGALHDLANR | No | Alternative | Junction | 10 | 3 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page