top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr10|94306426|94308699|+|2|circRNA|PLCE1|NM_001288989|26,27 | circPLCE1(26,27) | PLCE1 | MKSWRFLVYSLTAEGWKKIPLAIPCQPLRLSLVRMCAPVIAWEARALKSTSWACLWTAAISAQSPSIETP | MCAPVIAWEARALK | No | Alternative | Junction | 14 | 1 | ATG | TGA | TransCirc | No |
chr10|94474667|94497172|+|3|circRNA|TBC1D12|NM_015188|3,4,5 | circTBC1D12(3,4,5) | TBC1D12 | MKERFKQEENIASAMVIWINEILPNWEVMNMKHERGGPVNHHLSLQDARILNLSRFLPLP | GGPVNHHLSLQDAR | No | Alternative | Junction | 14 | 3 | ATG | TGA | TransCirc | No |
chr10|94474667|94497172|+|3|circRNA|TBC1D12|NM_015188|3,4,5 | circTBC1D12(3,4,5) | TBC1D12 | MKERFKQEENIASAMVIWINEILPNWEVMNMKHERGGPVNHHLSLQDARILNLSRFLPLP | HERGGPVNHHLSLQDAR | No | Alternative | Junction | 17 | 3 | ATG | TGA | TransCirc | No |
chr10|94474667|94511654|+|7|circRNA|TBC1D12|NM_015188|3,4,5,6,7,8,9 | circTBC1D12(3,4,5,6,7,8,9) | TBC1D12 | LMLVMNMKHERGGPVNHHLSLQDARILNLSRFLPLP | LMLVMNMK | No | Alternative | Junction | 8 | 2 | CTG | TGA | TransCirc | No |
chr10|94474667|94511654|+|7|circRNA|TBC1D12|NM_015188|3,4,5,6,7,8,9 | circTBC1D12(3,4,5,6,7,8,9) | TBC1D12 | LMLVMNMKHERGGPVNHHLSLQDARILNLSRFLPLP | LMLVMNMKHER | No | Junction | Junction | 11 | 2 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page