top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr10|110889630|110890555|+|1|ciRNA|PDCD4|ENST00000393104.6|8 | ciPDCD4(8) | PDCD4 | MRNEIEHENINMRINFFLLLFVLKKCFEFYFAFMLCERFRAYRILSALSLI | ILSALSLI | No | Alternative | Alternative | 8 | 1 | ATG | TAG | NA | No |
chr10|110889630|110890555|+|1|ciRNA|PDCD4|ENST00000393104.6|8 | ciPDCD4(8) | PDCD4 | MRNEIEHENINMRINFFLLLFVLKKCFEFYFAFMLCERFRAYRILSALSLI | MRNEIEHENINMR | No | Alternative | Alternative | 13 | 1 | ATG | TAG | NA | No |
chr10|112172318|112172969|-|1|ciRNA|GPAM|ENST00000348367.8|8 | ciGPAM(8) | GPAM | LLFFPQLISVVIVALFLFSSESITLKEVPIIGKCF | EVPIIGK | No | Alternative | Alternative | 7 | 2 | TTG | TAA | NA | No |
chr10|115120184|115334419|+|18|circRNA|ATRNL1|NM_207303|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19 | circATRNL1(2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19) | ATRNL1 | MDIALASIIMCANSVKISPQESSVKIVCQVIMEIQPMVDSAQVNRTFWIFNRWPN | ISPQESSVKIVCQVIMEIQPMVDSAQVNR | No | Junction | Junction | 29 | 1 | ATG | TAA | TransCirc | No |
chr10|115120184|115334419|+|18|circRNA|ATRNL1|NM_207303|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19 | circATRNL1(2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19) | ATRNL1 | MDIALASIIMCANSVKISPQESSVKIVCQVIMEIQPMVDSAQVNRTFWIFNRWPN | IVCQVIMEIQPMVDSAQVNR | No | Junction | Junction | 20 | 1 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page