top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|58506059|58536741|-|6|circRNA|OMA1|ENST00000421528.6|7,6,5,4,3,2 | circOMA1(7,6,5,4,3,2) | OMA1 | MEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQGHKEMVAGTSS | EMVAGTSS | No | Alternative | Junction | 8 | 1 | ATG | TAA | TransCirc | No |
chr1|5873251|5986327|-|19|circRNA|NPHP4|NM_001291593|20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2 | circNPHP4(20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2) | NPHP4 | LAQDLHPKRACPSPPTESAPALEGIHGIPVCPQVAGRTGN | LAQDLHPK | No | Alternative | Alternative | 8 | 2 | CTG | TAG | NA | No |
chr1|5873251|5986327|-|19|circRNA|NPHP4|NM_001291593|20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2 | circNPHP4(20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2) | NPHP4 | LAQDLHPKRACPSPPTESAPALEGIHGIPVCPQVAGRTGN | LAQDLHPKR | No | Alternative | Alternative | 9 | 2 | CTG | TAG | NA | No |
chr1|5873251|5986327|-|19|circRNA|NPHP4|NM_001291593|20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2 | circNPHP4(20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2) | NPHP4 | LAQDLHPKRACPSPPTESAPALEGIHGIPVCPQVAGRTGN | RACPSPPTESAPALEGIHGIPVCPQVAGR | No | Alternative | Alternative | 29 | 2 | CTG | TAG | TransCirc | No |
chr1|5873251|5986327|-|19|circRNA|NPHP4|NM_001291593|20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2 | circNPHP4(20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2) | NPHP4 | LSNEKGMDAVSPWKSSAVPTKHAKIIREAHGTLRRAG | EAHGTLR | No | Alternative | Junction | 7 | 1 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page