top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|45654542|45655319|-|2|circRNA|GPBP1L1|ENST00000290795.7|5,4 | circGPBP1L1(5,4) | GPBP1L1 | MAASTPGKGVLFRKSHLWRLGKKRKKTRWKSCSLKRRTFHLLPPSKNTESTYPEEKVDLE | RTFHLLPPSK | No | Junction | Junction | 10 | 1 | ATG | TAA | TransCirc | No |
chr1|46055794|46066179|-|3|circRNA|PIK3R3|ENST00000262741.9|7,6,5 | circPIK3R3(7,6,5) | PIK3R3 | MMNYDKLKSRLGEIHDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVISW | IRDQHLVISW | No | Junction | Junction | 10 | 2 | ATG | TAA | TransCirc | No |
chr1|47368468|47374985|+|3|circRNA|CMPK1|ENST00000371873.9|2,3,4 | circCMPK1(2,3,4) | CMPK1 | LNDVLRGERVVVGVMTTERAWKREIWLHTPFCRRAAS | VVVGVMTTERAWK | No | Alternative | Junction | 13 | 2 | TTG | TGA | TransCirc | No |
chr1|48355669|48399644|-|5|circRNA|SPATA6|ENST00000371847.7|11,10,9,8,7 | circSPATA6(11,10,9,8,7) | SPATA6 | MINLFTIWLQLKNHMADCKTEHQDHKRKNPSHLREVNTV | INLFTIWLQLK | No | Alternative | Junction | 11 | 3 | ATG | TAA | TransCirc | No |
chr1|51781163|51782643|+|2|circRNA|OSBPL9|ENST00000371714.5|18,19 | circOSBPL9(18,19) | OSBPL9 | MVPLSLSCGKERISCQKAIQSHFGRDFSVSLDITK | AIQSHFGRDFSVSLDITK | No | Alternative | Alternative | 18 | 2 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page