top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|32944018|32949774|-|5|circRNA|RNF19B|ENST00000373456.11|6,5,4,3,2 | circRNF19B(6,5,4,3,2) | RNF19B | MLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVMLLLPMAVPAARS | GVKIEFDEDDGPITVMLLLPMAVPAAR | No | Junction | Junction | 27 | 3 | ATG | TAA | TransCirc | No |
chr1|32944018|32949774|-|5|circRNA|RNF19B|ENST00000373456.11|6,5,4,3,2 | circRNF19B(6,5,4,3,2) | RNF19B | MLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVMLLLPMAVPAARS | IEFDEDDGPITVMLLLPMAVPAAR | No | Junction | Junction | 24 | 3 | ATG | TAA | TransCirc | No |
chr1|32944018|32949774|-|5|circRNA|RNF19B|ENST00000373456.11|6,5,4,3,2 | circRNF19B(6,5,4,3,2) | RNF19B | MLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVMLLLPMAVPAARS | IEFDEDDGPITVMLLLPMAVPAARS | No | Junction | Junction | 25 | 3 | ATG | TAA | TransCirc | No |
chr1|33354400|33355253|-|2|circRNA|PHC2|ENST00000431992.5|7,6 | circPHC2(7,6) | PHC2 | LMTGKKWHQGRKVCLRRGLAHHHISRLLSLPCLVACLYPRALTSSRPQLTPMLSCSHTSSSHSHPQSTCSPNL | RGLAHHHISR | No | Alternative | Junction | 10 | 2 | CTG | TGA | NA | No |
chr1|35014696|35030713|-|5|circRNA|RP11-244H3.4|ENST00000487874.1|6,5,4,3,2 | circRP11-244H3.4(6,5,4,3,2) | RP11-244H3.4 | MNCCENCGSYCYSSSGPCQSQKVFSSTSVTAYKQVSNYPLPRRNLFV | QVSNYPLPR | No | Junction | Junction | 9 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page