top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|179043714|179064496|+|5|circRNA|FAM20B|ENST00000263733.4|2,3,4,5,6 | circFAM20B(2,3,4,5,6) | FAM20B | LDIIDTAVFDYLIGNADRHHYESFQDDEGASMLILLDNAKRNCGRCISEEMDQCV | HHYESFQDDEGASMLILLDNAKR | No | Alternative | Junction | 23 | 2 | TTG | TAA | NA | No |
chr1|179852631|179865854|-|2|circRNA|TOR1AIP2|NM_001199260|4,3 | circTOR1AIP2(4,3) | TOR1AIP2 | LGTCVTTARVPAPTKDPLDLSAPLFHQADTITLPTKQSKPSASV | LGTCVTTAR | No | Alternative | Alternative | 9 | 2 | TTG | TGA | NA | No |
chr1|179852631|179865854|-|2|circRNA|TOR1AIP2|NM_001199260|4,3 | circTOR1AIP2(4,3) | TOR1AIP2 | LINVLPRQTSLDPRSRGLCQVFLTPLHCYKVPRP | QTSLDPRSR | No | Alternative | Alternative | 9 | 2 | CTG | TAA | NA | No |
chr1|179990506|180014505|+|7|circRNA|CEP350|ENST00000367607.7|4,5,6,7,8,9,10 | circCEP350(4,5,6,7,8,9,10) | CEP350 | MKIPLLFPKGATMTQMRYDSTLLGSRRKGRESKMKRRRLKRRLQNRKTNDYKSSTGSRRKPLLK | YDSTLLGSR | No | Alternative | Alternative | 9 | 1 | ATG | TAA | NA | No |
chr1|180033861|180044173|+|6|circRNA|CEP350|ENST00000367607.7|16,17,18,19,20,21 | circCEP350(16,17,18,19,20,21) | CEP350 | LFHSLRVKKGPLTQSIRSILLHMIVILSLQDTRIMIEVSHQIREDLRKLQLLPCHQVPRNHCSLTLQELLQKDLSRQ | LQLLPCHQVPR | No | Alternative | Junction | 11 | 3 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page