top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr1|156475107|156483430|-|8|circRNA|MEF2D|NM_005920|9,8,7,6,5,4,3,2 | circMEF2D(9,8,7,6,5,4,3,2) | MEF2D | MPSALGSPSLLIRSPPQWFLWQRRVYSARASPSLPCPLPTTQEAVQKVSCRP | ASPSLPCPLPTTQEAVQKVSCRP | No | Junction | Junction | 23 | 2 | ATG | TGA | TransCirc | No |
chr1|156482436|156483430|-|2|circRNA|MEF2D|NM_005920|3,2 | circMEF2D(3,2) | MEF2D | MSHTRAAPTPTSSRRLCRRYPADHELSTVPRPFMSTV | AAPTPTSSR | No | Alternative | Junction | 9 | 2 | ATG | TAA | NA | No |
chr1|159918837|159920537|-|4|circRNA|TAGLN2|ENST00000397334.2|5,4,3,2 | circTAGLN2(5,4,3,2) | TAGLN2 | LQEGKNVIGLQMGTNRGASQAAPRSHRHPLEWPTGDLHMA | GASQAAPR | No | Alternative | Junction | 8 | 2 | CTG | TGA | TransCirc | No |
chr1|16148377|16149047|-|1|circRNA|EPHA2|ENST00000358432.7|3 | circEPHA2(3) | EPHA2 | LATRTTGSAPTGCTEERLSVSSLSSSLLYVTATASLVAPAPARRLSTSTMPSRTWTTAPTSRSACSPRLTPLRPMRSPSAATSRHAT | SPSAATSR | Yes | Alternative | Alternative | 8 | 2 | CTG | TGA | TransCirc | No |
chr1|161791407|161802272|+|3|circRNA|ATF6|NM_007348|5,6,7 | circATF6(5,6,7) | ATF6 | MSVQMRSWICLLVLRCLPFPYMVKTLIVSLQRSH | TLIVSLQR | No | Alternative | Junction | 8 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page