top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr12|50200776|50222485|-|4|circRNA|LIMA1|NM_001113546|7,6,5,4 | circLIMA1(7,6,5,4) | LIMA1 | LLLEPKLTKKNKSTPDLDSGHLLKPSFRVDIPTSRTVRILKTTQQKVKKWKIV | VDIPTSR | No | Alternative | Alternative | 7 | 2 | CTG | TAG | TransCirc | No |
chr12|50685832|50724886|+|18|circRNA|DIP2B|NM_173602|11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28 | circDIP2B(11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28) | DIP2B | MRLLRSREAAAAVDVKTWPTIIDTGCWRSADWLLARKLWYCLSSYQ | EAAAAVDVKTWPTIIDTGCWR | No | Junction | Junction | 21 | 1 | ATG | TGA | TransCirc | No |
chr12|50704139|50714596|+|4|circRNA|DIP2B|NM_173602|20,21,22,23 | circDIP2B(20,21,22,23) | DIP2B | LSCSGASQYIAKNSTRRNPYISDETTLSGGITASLQHPHVPPYMCDKLAKAPAKTTR | LSCSGASQYIAKNSTR | No | Alternative | Alternative | 16 | 3 | TTG | TAA | NA | No |
chr12|50704139|50714596|+|4|circRNA|DIP2B|NM_173602|20,21,22,23 | circDIP2B(20,21,22,23) | DIP2B | LSCSGASQYIAKNSTRRNPYISDETTLSGGITASLQHPHVPPYMCDKLAKAPAKTTR | NPYISDETTLSGGITASLQHPHVPPYMCDK | No | Alternative | Alternative | 30 | 3 | TTG | TAA | NA | No |
chr12|50704139|50714596|+|4|circRNA|DIP2B|NM_173602|20,21,22,23 | circDIP2B(20,21,22,23) | DIP2B | LSCSGASQYIAKNSTRRNPYISDETTLSGGITASLQHPHVPPYMCDKLAKAPAKTTR | RNPYISDETTLSGGITASLQHPHVPPYMCDK | No | Alternative | Alternative | 31 | 3 | TTG | TAA | NA | No |
Page 1 of 1
bottom of page