top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|108169497|108184682|-|3|circRNA|LINC01594|ENST00000445083.1|4,3,2 | circLINC01594(4,3,2) | LINC01594 | LNPSRHCYNRRDKMFYRNQSLSFTQALTWWQYVREDCLFQSLVLSFAIYRWFILATCARM | WFILATCAR | No | Alternative | Junction | 9 | 1 | TTG | TGA | TransCirc | No |
chr2|109432500|109449489|+|3|circRNA|SH3RF3|ENST00000309415.7|6,7,8 | circSH3RF3(6,7,8) | SH3RF3 | LPTLQPRLRTGQLPPCHPCAPRTLHPACLPPASGPTRWCPRSTATSPRCRCAHGRPSPSHQQHQPSHLPTSVPQTSTGRLEGGPSVFCPHPAPPTRDAN | LPTLQPR | No | Alternative | Alternative | 7 | 1 | CTG | TAG | TransCirc | No |
chr2|109819695|109838042|+|13|circRNA|RGPD5|NM_001123363|9,10,11,12,13,14,15,16,17,18,19,20,21 | circRGPD5(9,10,11,12,13,14,15,16,17,18,19,20,21) | RGPD5 | LCLLMDLNLAFRNQEIKKRKGKSLLKMILASRLRILVAGRRAVV | MILASRLR | No | Alternative | Alternative | 8 | 2 | CTG | TGA | NA | No |
chr2|109819695|109838042|+|13|circRNA|RGPD5|NM_001123363|9,10,11,12,13,14,15,16,17,18,19,20,21 | circRGPD5(9,10,11,12,13,14,15,16,17,18,19,20,21) | RGPD5 | LKYPVVRKMNKLFLVTGQKSTDMIKMLVNGKKGALVI | MLVNGKK | No | Alternative | Alternative | 7 | 2 | TTG | TAA | NA | No |
chr2|111123869|111124088|+|1|ciRNA|BCL2L11|ENST00000615946.4|2 | ciBCL2L11(2) | BCL2L11 | LKAITEVKGTAAPTAALRARWPHLPALALLLPDPRFSSL | GTAAPTAALR | No | Alternative | Alternative | 10 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page