top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr19|47725811|47726224|+|1|circRNA|EHD2|ENST00000263277.7|4 | circEHD2(4) | EHD2 | LMRTSWRSRTSSQRPSARCGAMRTRSAWCSTRPTWWRRSS | SRTSSQRPSAR | No | Alternative | Alternative | 11 | 1 | TTG | TGA | TransCirc | No |
chr19|47725811|47736533|+|2|circRNA|EHD2|ENST00000263277.7|4,5 | circEHD2(4,5) | EHD2 | LRRFSWNITSPLGTFLIARKCRLRLPGRAALVRGARGPHHPAL | FSWNITSPLGTFLIAR | No | Alternative | Junction | 16 | 2 | TTG | TGA | TransCirc | No |
chr19|48874898|48875530|+|1|ciRNA|PPP1R15A|ENST00000200453.5|2 | ciPPP1R15A(2) | PPP1R15A | LSLRKKGGWGPRLLGPCMLQRVACHLHGEGCVRCHAIPCKRPGPWGRREQLWLTAAPGNHLFLQ | KGGWGPR | No | Alternative | Alternative | 7 | 1 | TTG | TGA | NA | No |
chr19|48970545|48971023|-|2|circRNA|GYS1|ENST00000323798.7|14,13 | circGYS1(14,13) | GYS1 | LTGGSAAWMIPARSSPPSSTVSVSRAGGSVSSSGTARSASPTFWTGNT | AGGSVSSSGTAR | No | Alternative | Alternative | 12 | 1 | TTG | TAG | TransCirc | No |
chr19|48970545|48971023|-|2|circRNA|GYS1|ENST00000323798.7|14,13 | circGYS1(14,13) | GYS1 | LTGGSAAWMIPARSSPPSSTVSVSRAGGSVSSSGTARSASPTFWTGNT | SSPPSSTVSVSR | No | Alternative | Alternative | 12 | 1 | TTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page