top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr18|25224344|25227697|-|1|circRNA|ZNF521|NM_001308225|3 | circZNF521(3) | ZNF521 | LTSRKTSKNTLQSATPNAPQMRTERPSSVSTATSSS | TERPSSVSTATSSS | No | Alternative | Alternative | 14 | 1 | TTG | TAG | TransCirc | No |
chr18|25224344|25227697|-|1|circRNA|ZNF521|NM_001308225|3 | circZNF521(3) | ZNF521 | MQSQQQPFPGHGGLYLRVQYDSRFQPLSGQLNHGGSCPANPKESREEEGRSTNP | MQSQQQPFPGHGGLYLR | No | Alternative | Alternative | 17 | 1 | ATG | TGA | TransCirc | No |
chr18|26032398|26057742|-|7|circRNA|SS18|ENST00000415083.6|10,9,8,7,6,5,4 | circSS18(10,9,8,7,6,5,4) | SS18 | MEDIDQHSLDHHSHPSRGLMDMTSHPHRICLWVLEG | GLMDMTSHPHR | No | Junction | Junction | 11 | 1 | ATG | TGA | TransCirc | No |
chr18|2732264|2775924|+|18|circRNA|SMCHD1|ENST00000320876.10|25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42 | circSMCHD1(25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42) | SMCHD1 | LTLHVVSMMKPKVVSRCCPLILFTRRLFQIGKEL | CCPLILFTRR | No | Alternative | Junction | 10 | 2 | CTG | TAA | TransCirc | No |
chr18|2732264|2775924|+|18|circRNA|SMCHD1|ENST00000320876.10|25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42 | circSMCHD1(25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42) | SMCHD1 | LTLHVVSMMKPKVVSRCCPLILFTRRLFQIGKEL | LTLHVVSMMKPK | No | Alternative | Junction | 12 | 2 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page