top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|80317187|80348286|+|14|circRNA|RNF213|NM_001256071|16,17,18,19,20,21,22,23,24,25,26,27,28,29 | circRNF213(16,17,18,19,20,21,22,23,24,25,26,27,28,29) | RNF213 | LQRNFPKTLPVFKTIQSKPRPRHVSVSRRLCRRHPGGMPPAFPVSLRGNKPILVRASELCSVPELSAQRL | GNKPILVR | No | Alternative | Alternative | 8 | 3 | CTG | TGA | TransCirc | No |
chr17|80317187|80348286|+|14|circRNA|RNF213|NM_001256071|16,17,18,19,20,21,22,23,24,25,26,27,28,29 | circRNF213(16,17,18,19,20,21,22,23,24,25,26,27,28,29) | RNF213 | LQRNFPKTLPVFKTIQSKPRPRHVSVSRRLCRRHPGGMPPAFPVSLRGNKPILVRASELCSVPELSAQRL | GNKPILVRASELCSVPELSAQR | No | Alternative | Alternative | 22 | 3 | CTG | TGA | TransCirc | No |
chr17|80317187|80348286|+|14|circRNA|RNF213|NM_001256071|16,17,18,19,20,21,22,23,24,25,26,27,28,29 | circRNF213(16,17,18,19,20,21,22,23,24,25,26,27,28,29) | RNF213 | LQRNFPKTLPVFKTIQSKPRPRHVSVSRRLCRRHPGGMPPAFPVSLRGNKPILVRASELCSVPELSAQRL | HPGGMPPAFPVSLR | No | Alternative | Alternative | 14 | 3 | CTG | TGA | TransCirc | No |
chr17|80317187|80348286|+|14|circRNA|RNF213|NM_001256071|16,17,18,19,20,21,22,23,24,25,26,27,28,29 | circRNF213(16,17,18,19,20,21,22,23,24,25,26,27,28,29) | RNF213 | LQSEFYWRHTEGLQEVRGDLHDLYGKRFCHTITPHL | GDLHDLYGK | No | Alternative | Alternative | 9 | 3 | CTG | TGA | TransCirc | No |
chr17|80317187|80348286|+|14|circRNA|RNF213|NM_001256071|16,17,18,19,20,21,22,23,24,25,26,27,28,29 | circRNF213(16,17,18,19,20,21,22,23,24,25,26,27,28,29) | RNF213 | MSSQPTICLKSLPSRCGSGVGSRLSSWEKLAVGKPGLLNSLATCGVVVPMLTP | LAVGKPGLLNSLATCGVVVPMLTP | No | Alternative | Alternative | 24 | 2 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page