top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|64521401|64534737|+|11|circRNA|CEP95|ENST00000556440.6|7,8,9,10,11,12,13,14,15,16,17 | circCEP95(7,8,9,10,11,12,13,14,15,16,17) | CEP95 | LTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMVLNVLMKCCLKKP | EEMVLNVLMK | No | Junction | Junction | 10 | 1 | TTG | TAG | TransCirc | No |
chr17|64521401|64534737|+|11|circRNA|CEP95|ENST00000556440.6|7,8,9,10,11,12,13,14,15,16,17 | circCEP95(7,8,9,10,11,12,13,14,15,16,17) | CEP95 | LTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMVLNVLMKCCLKKP | EEMVLNVLMKCCLK | No | Junction | Junction | 14 | 1 | TTG | TAG | TransCirc | No |
chr17|64521401|64534737|+|11|circRNA|CEP95|ENST00000556440.6|7,8,9,10,11,12,13,14,15,16,17 | circCEP95(7,8,9,10,11,12,13,14,15,16,17) | CEP95 | LTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMVLNVLMKCCLKKP | TREEMVLNVLMK | No | Junction | Junction | 12 | 1 | TTG | TAG | TransCirc | No |
chr17|64561499|64571956|-|3|circRNA|SMURF2|ENST00000582081.5|12,11,10 | circSMURF2(12,11,10) | SMURF2 | LTMEALPGILATSIVKSLVHCLLDGRSVIRQQAEFISLTITTEQHNLQILGCLLTCI | LTMEALPGILATSIVK | No | Junction | Junction | 16 | 2 | TTG | TAG | TransCirc | No |
chr17|66175043|66183307|-|3|circRNA|CEP112|ENST00000535342.6|4,3,2 | circCEP112(4,3,2) | CEP112 | LGELETSEHKLNESWKLSSGEDNTLVQSPTDVYRLDYGSGK | LDYGSGK | No | Alternative | Junction | 7 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page