top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|1786809|1801024|-|3|circRNA|SMYD4|ENST00000305513.11|7,6,5 | circSMYD4(7,6,5) | SMYD4 | MPSIAARSVCSRPGSSTTGQNVLWEGCFSHWVSFATLP | MPSIAAR | No | Alternative | Alternative | 7 | 1 | ATG | TGA | TransCirc | No |
chr17|1786809|1801024|-|3|circRNA|SMYD4|ENST00000305513.11|7,6,5 | circSMYD4(7,6,5) | SMYD4 | MRRSFKRSLSRCHKRYSPRRAPGAGGCFCECSQPRRTATTASRPRQQMGHQSHQWGPLLSPMFEAHFGHSSV | TATTASRPR | No | Alternative | Alternative | 9 | 2 | ATG | TGA | TransCirc | No |
chr17|18280535|18282841|-|2|circRNA|TOP3A|ENST00000542570.5|17,16 | circTOP3A(17,16) | TOP3A | LSATPCVQIGRGLGPVLWEWDRVGPARRYLPSHARAHQEVPTVQQGHGP | GLGPVLWEWDRVGPAR | No | Alternative | Junction | 16 | 1 | TTG | TAA | TransCirc | No |
chr17|18280535|18282841|-|2|circRNA|TOP3A|ENST00000542570.5|17,16 | circTOP3A(17,16) | TOP3A | LSATPCVQIGRGLGPVLWEWDRVGPARRYLPSHARAHQEVPTVQQGHGP | LSATPCVQIGR | No | Junction | Junction | 11 | 1 | TTG | TAA | TransCirc | No |
chr17|18282697|18291027|-|5|circRNA|TOP3A|ENST00000542570.5|16,15,14,13,12 | circTOP3A(16,15,14,13,12) | TOP3A | LLLPGCSGAGDHSGDRHRSGTLCGPWPHDSGPKLSGCVSI | SGTLCGPWPHDSGPK | No | Alternative | Alternative | 15 | 3 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page