top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|24930783|24942143|-|4|circRNA|ARHGAP17|NM_001006634|19,18,17,16 | circARHGAP17(19,18,17,16) | ARHGAP17 | MYQKHLYLSPPRVLITHSTLETTLTRGPWRGSGLLAWR | GPWRGSGLLAWR | No | Alternative | Alternative | 12 | 1 | ATG | TGA | TransCirc | No |
chr16|24930783|24942143|-|4|circRNA|ARHGAP17|NM_001006634|19,18,17,16 | circARHGAP17(19,18,17,16) | ARHGAP17 | MYQKHLYLSPPRVLITHSTLETTLTRGPWRGSGLLAWR | GSGLLAWR | No | Alternative | Alternative | 8 | 1 | ATG | TGA | TransCirc | No |
chr16|24930783|24942143|-|4|circRNA|ARHGAP17|NM_001006634|19,18,17,16 | circARHGAP17(19,18,17,16) | ARHGAP17 | MYQKHLYLSPPRVLITHSTLETTLTRGPWRGSGLLAWR | HLYLSPPR | No | Alternative | Alternative | 8 | 1 | ATG | TGA | TransCirc | No |
chr16|25243784|25252035|-|3|circRNA|ZKSCAN2|NM_001012981|6,5,4 | circZKSCAN2(6,5,4) | ZKSCAN2 | LLLPPAPQRKSHHLQGKKEGVLRLNPRNLQAGNLKRPHRRQ | EGVLRLNPR | No | Alternative | Alternative | 9 | 1 | CTG | TAA | TransCirc | No |
chr16|2577424|2581703|+|3|circRNA|PDPK1|ENST00000342085.8|7,8,9 | circPDPK1(7,8,9) | PDPK1 | MTFQKNSSLRQETSWRNFCQGQLIRGNSAVRFSRAAHGEVRL | AAHGEVR | No | Alternative | Junction | 7 | 3 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page