top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|38477286|38482560|+|9|circRNA|ACVR2B|ENST00000352511.4|2,3,4,5,6,7,8,9,10 | circACVR2B(2,3,4,5,6,7,8,9,10) | ACVR2B | LGAGAHQPERPGALRRRAGQAAALLRLLAQQLWHHRAREEGLLAR | RAGQAAALLR | No | Alternative | Alternative | 10 | 1 | CTG | TGA | TransCirc | No |
chr3|40189825|40190463|+|1|circRNA|MYRIP|ENST00000444716.5|10 | circMYRIP(10) | MYRIP | LPPHPLHSPPTLRPCALTRRPPPQALPEKLGTRPDCPGCRGRPPGTLQLRRCACMESWT | GRPPGTLQLRR | No | Alternative | Alternative | 11 | 1 | CTG | TGA | TransCirc | No |
chr3|41681507|41705305|-|4|circRNA|ULK4|NM_017886|29,28,27,26 | circULK4(29,28,27,26) | ULK4 | LRLLSETTSLLVNQEFGDGKEKASVDSDSNLLALIRDVLLPQVILNL | DVLLPQVILNL | No | Junction | Junction | 11 | 3 | TTG | TAG | TransCirc | No |
chr3|42087103|42087400|+|1|circRNA|TRAK1|ENST00000487159.5|2 | circTRAK1(2) | TRAK1 | LWKMLPATEGTGMPAPLLIPYKEPLLVHQNYRGPSAQLPQTLAVGPPMAVGTSP | GPSAQLPQTLAVGPPMAVGTSP | No | Alternative | Junction | 22 | 1 | CTG | TGA | TransCirc | No |
chr3|42528123|42530943|+|1|ciRNA|VIPR1|ENST00000446673.5|5 | ciVIPR1(5) | VIPR1 | LQVGCKAAMVFFQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYFWGYILIGWGMVPVRILALAHLPQSRRYL | ILALAHLPQSR | No | Alternative | Junction | 11 | 1 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page