top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|168309304|168314176|+|2|circRNA|EGFEM1P|NR_021485|2,3 | circEGFEM1P(2,3) | EGFEM1P | LQWELVSMEENAQMVKASSASVQRDFMDPTVNNSQVFVKNSK | DFMDPTVNNSQVFVKNSK | No | Junction | Junction | 18 | 1 | CTG | TGA | NA | No |
chr3|17009673|17014911|+|2|circRNA|PLCL2|ENST00000615277.4|2,3 | circPLCL2(2,3) | PLCL2 | LSLSSKNCINQRTKLVPRSQRKNLLRFFMSFVLDLKFISF | NCINQRTK | No | Alternative | Alternative | 8 | 2 | TTG | TAG | NA | No |
chr3|171642839|171674613|-|5|circRNA|PLD1|ENST00000356327.9|22,21,20,19,18 | circPLD1(22,21,20,19,18) | PLD1 | MCRGENSILGQLKAEHYEIKISVPFLSFSASKVSNNSP | AEHYEIKISVPFLSFSASK | No | Junction | Junction | 19 | 2 | ATG | TGA | TransCirc | No |
chr3|171642839|171674613|-|5|circRNA|PLD1|ENST00000356327.9|22,21,20,19,18 | circPLD1(22,21,20,19,18) | PLD1 | MCRGENSILGQLKAEHYEIKISVPFLSFSASKVSNNSP | GENSILGQLKAEHYEIK | No | Junction | Junction | 17 | 2 | ATG | TGA | TransCirc | No |
chr3|171642839|171674613|-|5|circRNA|PLD1|ENST00000356327.9|22,21,20,19,18 | circPLD1(22,21,20,19,18) | PLD1 | MCRGENSILGQLKAEHYEIKISVPFLSFSASKVSNNSP | ISVPFLSFSASK | No | Alternative | Junction | 12 | 2 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page