top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|122692300|122708268|+|6|circRNA|PARP14|ENST00000474629.6|4,5,6,7,8,9 | circPARP14(4,5,6,7,8,9) | PARP14 | MNLPEGLMEISSVTKFRRLKIHKMCQKNWIQNSLLMVD | NWIQNSLLMVD | No | Alternative | Junction | 11 | 2 | ATG | TAG | TransCirc | No |
chr3|122699389|122701635|+|1|circRNA|PARP14|ENST00000474629.6|6 | circPARP14(6) | PARP14 | MKEDRESRPGRQILPQHSLASGLNIKSTQLKWIQQCGTP | EDRESRPGR | No | Alternative | Alternative | 9 | 1 | ATG | TAA | TransCirc | No |
chr3|122703741|122708268|+|3|circRNA|PARP14|ENST00000474629.6|7,8,9 | circPARP14(7,8,9) | PARP14 | MLLSTPFPWISCLVEGLFLSPSWKKLDQSSRRNWTQLDKGWLSAWAQCSKPAAGIWTVAMCFTW | MLLSTPFPWISCLVEGLFLSPSWK | No | Alternative | Alternative | 24 | 3 | ATG | TAG | TransCirc | No |
chr3|122718358|122718958|+|1|circRNA|PARP14|ENST00000474629.6|14 | circPARP14(14) | PARP14 | LPQTQRATVYLFSASRNPKHFWAFQSNLPKKRIIWFWKRKQNQQLFGCVVKMSRVWNMLSPGYKT | HFWAFQSNLPK | No | Alternative | Junction | 11 | 1 | CTG | TGA | TransCirc | No |
chr3|122718358|122718958|+|1|circRNA|PARP14|ENST00000474629.6|14 | circPARP14(14) | PARP14 | LPQTQRATVYLFSASRNPKHFWAFQSNLPKKRIIWFWKRKQNQQLFGCVVKMSRVWNMLSPGYKT | KQNQQLFGCVVK | No | Alternative | Junction | 12 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page