top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr20|47249286|47310204|-|11|circRNA|ZMYND8|ENST00000311275.11|13,12,11,10,9,8,7,6,5,4,3 | circZMYND8(13,12,11,10,9,8,7,6,5,4,3) | ZMYND8 | LALQREQPRKESSPALHILPMATRRRTHQQAPLKRKRNLAY | KESSPALHILPMATR | No | Alternative | Alternative | 15 | 1 | CTG | TGA | NA | No |
chr20|47249286|47310204|-|11|circRNA|ZMYND8|ENST00000311275.11|13,12,11,10,9,8,7,6,5,4,3 | circZMYND8(13,12,11,10,9,8,7,6,5,4,3) | ZMYND8 | LALQREQPRKESSPALHILPMATRRRTHQQAPLKRKRNLAY | THQQAPLK | No | Alternative | Alternative | 8 | 1 | CTG | TGA | NA | No |
chr20|47249286|47310204|-|11|circRNA|ZMYND8|ENST00000311275.11|13,12,11,10,9,8,7,6,5,4,3 | circZMYND8(13,12,11,10,9,8,7,6,5,4,3) | ZMYND8 | LALQREQPRKESSPALHILPMATRRRTHQQAPLKRKRNLAY | THQQAPLKR | No | Alternative | Alternative | 9 | 1 | CTG | TGA | NA | No |
chr20|47276313|47276795|-|1|circRNA|ZMYND8|ENST00000311275.11|11 | circZMYND8(11) | ZMYND8 | LCTRAPTWSRMLRRRPRRATSVRARSPWTSWIRAQGLGSNK | ARSPWTSWIR | No | Alternative | Junction | 10 | 3 | CTG | TAA | TransCirc | No |
chr20|47276313|47276795|-|1|circRNA|ZMYND8|ENST00000311275.11|11 | circZMYND8(11) | ZMYND8 | LCTRAPTWSRMLRRRPRRATSVRARSPWTSWIRAQGLGSNK | ATSVRAR | No | Alternative | Junction | 7 | 3 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page