top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr20|3854557|3857809|+|2|circRNA|MAVS|NM_020746|2,3 | circMAVS(2,3) | MAVS | LISRTKWPLSTRATSLSRFLSVHPPFMGPEPSLQNLSSNAVC | FLSVHPPFMGPEPSLQNLSSNAVC | No | Alternative | Junction | 24 | 2 | TTG | TGA | TransCirc | No |
chr20|3857634|3861504|+|2|circRNA|MAVS|NM_020746|3,4 | circMAVS(3,4) | MAVS | LQREGAKLPHACPGDPGARVPRRGSTAGHLHTLREPGHPLASLQYPSAAARLGGVLHCGTEGL | LPHACPGDPGARVPR | Yes | Alternative | Junction | 15 | 2 | CTG | TGA | NA | No |
chr20|38941958|38948000|+|2|circRNA|FAM83D|ENST00000217429.8|2,3 | circFAM83D(2,3) | FAM83D | LMASAWQQAPTGDCSGHGRVHRHRHLQRPARNMQETGSCCVYPSGPGSPLSISGYVHGSESSS | HLQRPAR | No | Alternative | Junction | 7 | 2 | TTG | TGA | TransCirc | No |
chr20|41345795|41350397|+|6|circRNA|LPIN3|NM_001301860|2,3,4,5,6,7 | circLPIN3(2,3,4,5,6,7) | LPIN3 | MELGHSGGSSSHRAAREGLQGESTSHELRGAAGGDGVWDGEGAVPGPEPSHTERRH | MELGHSGGSSSHRAAR | No | Alternative | Junction | 16 | 3 | ATG | TGA | TransCirc | No |
chr20|41420507|41423700|-|2|circRNA|CHD6|ENST00000373233.7|31,30 | circCHD6(31,30) | CHD6 | LGYRGLSPLQQPVSATANTWRGGCMASRMMNLKSRNPRLISQICSKVKPILSPWRVNPLLFHHSRLK | GLSPLQQPVSATANTWR | No | Alternative | Alternative | 17 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page