top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|85630720|85639391|+|4|circRNA|USP39|NR_046347|6,7,8,9 | circUSP39(6,7,8,9) | USP39 | LPPSTRTRRSSSSFPKCHSSTSWLSSMASLRRLYLMFLLSGTTFWKKTIIRTSNVLQGISCSCWSSVLES | CHSSTSWLSSMASLR | No | Alternative | Junction | 15 | 2 | CTG | TGA | TransCirc | No |
chr2|85763990|85780538|+|2|circRNA|ATOH8|ENST00000473116.1|2,3 | circATOH8(2,3) | ATOH8 | LTDSEVCKHPLASVKEGFDHWPYLAPDLGPVGQLSAQHG | LTDSEVCK | No | Alternative | Alternative | 8 | 3 | TTG | TGA | NA | No |
chr2|85846376|85848204|-|2|circRNA|ST3GAL5|ENST00000393808.7|5,4 | circST3GAL5(5,4) | ST3GAL5 | LASSNGKKGNPESSEICSASLAEGMSSQVCQDINGAVI | LASSNGK | No | Alternative | Junction | 7 | 1 | CTG | TGA | TransCirc | No |
chr2|85846376|85863485|-|4|circRNA|ST3GAL5|ENST00000393808.7|5,4,3,2 | circST3GAL5(5,4,3,2) | ST3GAL5 | MTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLQCQVSTPM | KETLQCQVSTPM | No | Junction | Junction | 12 | 2 | ATG | TGA | TransCirc | No |
chr2|86065273|86070272|-|2|circRNA|POLR1A|ENST00000263857.10|14,13 | circPOLR1A(14,13) | POLR1A | LLFHPGALYGAGVPRTHGQSGAREAPFSFHPEALSAVDRKTGVPACEEWGHSATEPTAHTAQTLHPGPPCPHPA | THGQSGAR | No | Alternative | Junction | 8 | 3 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page